StarFunc result for job id Q14392

User Input

>input (662 residues)
MRPQILLLLALLTLGLAAQHQDKVPCKMVDKKVSCQVLGLLQVPSVLPPDTETLDLSGNQ
LRSILASPLGFYTALRHLDLSTNEISFLQPGAFQALTHLEHLSLAHNRLAMATALSAGGL
GPLPRVTSLDLSGNSLYSGLLERLLGEAPSLHTLSLAENSLTRLTRHTFRDMPALEQLDL
HSNVLMDIEDGAFEGLPRLTHLNLSRNSLTCISDFSLQQLRVLDLSCNSIEAFQTASQPQ
AEFQLTWLDLRENKLLHFPDLAALPRLIYLNLSNNLIRLPTGPPQDSKGIHAPSEGWSAL
PLSAPSGNASGRPLSQLLNLDLSYNEIELIPDSFLEHLTSLCFLNLSRNCLRTFEARRLG
SLPCLMLLDLSHNALETLELGARALGSLRTLLLQGNALRDLPPYTFANLASLQRLNLQGN
RVSPCGGPDEPGPSGCVAFSGITSLRSLSLVDNEIELLRAGAFLHTPLTELDLSSNPGLE
VATGALGGLEASLEVLALQGNGLMVLQVDLPCFICLKRLNLAENRLSHLPAWTQAVSLEV
LDLRNNSFSLLPGSAMGGLETSLRRLYLQGNPLSCCGNGWLAAQLHQGRVDVDATQDLIC
RFSSQEEVSLSHVRPEDCEKGGLKNINLIIILTFILVSAILLTTLAACCCVRRQKFNQQY
KA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R5J7	0.952	0.952	4.680E-98	662	1.000	1.000	A0A024R5J7.pdb.gz
2	AFDB:G3XA59	0.869	0.868	1.638E-77	663	0.795	0.793	G3XA59.pdb.gz	LRC32_MOUSE Transforming growth factor beta activator LRRC32 OS=Mus musculus OX=10090 GN=Lrrc32 PE=1 SV=1
3	PDB:6gffI	0.822	0.986	7.464E-74	551	0.832	1.000	6gffI.pdb.gz
4	AFDB:E7FFN8	0.830	0.834	5.660E-42	659	0.393	0.395	E7FFN8.pdb.gz	E7FFN8_DANRE Leucine-rich repeat-containing 32 OS=Danio rerio OX=7955 GN=lrrc32 PE=4 SV=1
5	AFDB:Q86YC3	0.764	0.733	8.678E-35	692	0.353	0.338	Q86YC3.pdb.gz	LRC33_HUMAN Transforming growth factor beta activator LRRC33 OS=Homo sapiens OX=9606 GN=NRROS PE=1 SV=1
6	AFDB:Q8BMT4	0.749	0.719	2.466E-32	693	0.343	0.328	Q8BMT4.pdb.gz	LRC33_MOUSE Transforming growth factor beta activator LRRC33 OS=Mus musculus OX=10090 GN=Nrros PE=1 SV=2
7	AFDB:F1LN63	0.527	0.414	1.303E-20	905	0.258	0.189	F1LN63.pdb.gz	F1LN63_RAT Toll-like receptor 3 OS=Rattus norvegicus OX=10116 GN=Tlr3 PE=3 SV=1
8	AFDB:O15455	0.492	0.388	8.957E-20	904	0.246	0.180	O15455.pdb.gz	TLR3_HUMAN Toll-like receptor 3 OS=Homo sapiens OX=9606 GN=TLR3 PE=1 SV=1
9	AFDB:B8JIL3	0.505	0.392	2.402E-19	903	0.252	0.185	B8JIL3.pdb.gz
10	AFDB:O75093	0.228	0.107	2.627E-19	1534	0.249	0.108	O75093.pdb.gz	SLIT1_HUMAN Slit homolog 1 protein OS=Homo sapiens OX=9606 GN=SLIT1 PE=1 SV=4
11	AFDB:F1RCV3	0.231	0.106	4.500E-19	1516	0.257	0.112	F1RCV3.pdb.gz	F1RCV3_DANRE Slit homolog 3 (Drosophila) OS=Danio rerio OX=7955 GN=zgc:111911 PE=1 SV=1
12	PDB:7wv3A	0.509	0.506	2.606E-16	668	0.237	0.235	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:3t6qA	0.471	0.511	3.511E-15	601	0.221	0.243	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:7tvfD	0.513	0.637	8.608E-15	515	0.208	0.268	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
15	PDB:7y1rE	0.566	0.855	2.485E-13	428	0.251	0.388	7y1rE.pdb.gz
16	PDB:7wrqA	0.513	0.587	5.826E-13	566	0.239	0.279	7wrqA.pdb.gz
17	PDB:3b2dA	0.442	0.481	1.787E-12	601	0.207	0.228	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:1xcdA	0.258	0.466	5.483E-12	305	0.131	0.285	1xcdA.pdb.gz
19	PDB:3j0aA	0.438	0.380	1.406E-11	797	0.208	0.173	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
20	PDB:6hkwA	0.335	0.691	1.835E-8	306	0.104	0.225	6hkwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3XA59	0.0	985	663	0.775	0.774	LRC32_MOUSE Transforming growth factor beta activator LRRC32 OS=Mus musculus OX=10090 GN=Lrrc32 PE=1 SV=1
2	Q14392	0.0	1311	662	1.000	1.000	LRC32_HUMAN Transforming growth factor beta activator LRRC32 OS=Homo sapiens OX=9606 GN=LRRC32 PE=1 SV=1
3	E7FFN8	1.26e-123	383	659	0.408	0.410	E7FFN8_DANRE Leucine-rich repeat-containing 32 OS=Danio rerio OX=7955 GN=lrrc32 PE=4 SV=1
4	Q86YC3	5.74e-88	291	692	0.353	0.338	LRC33_HUMAN Transforming growth factor beta activator LRRC33 OS=Homo sapiens OX=9606 GN=NRROS PE=1 SV=1
5	Q8BMT4	4.28e-84	280	693	0.361	0.345	LRC33_MOUSE Transforming growth factor beta activator LRRC33 OS=Mus musculus OX=10090 GN=Nrros PE=1 SV=2
6	Q965M2	8.05e-32	134	881	0.202	0.152	SMA10_CAEEL Leucine-rich repeats and immunoglobulin-like domains protein sma-10 OS=Caenorhabditis elegans OX=6239 GN=sma-10 PE=1 SV=1
7	A1Z9N6	2.55e-31	133	1092	0.278	0.168	A1Z9N6_DROME Acid labile subunit OS=Drosophila melanogaster OX=7227 GN=conv PE=2 SV=2
8	Q9VPF0	3.08e-29	127	1535	0.252	0.109	ATK_DROME Protein artichoke OS=Drosophila melanogaster OX=7227 GN=atk PE=1 SV=2
9	P35858	5.06e-26	115	605	0.257	0.281	ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens OX=9606 GN=IGFALS PE=1 SV=1
10	Q6P3Y9	4.02e-24	109	559	0.231	0.274	PONL1_MOUSE Podocan-like protein 1 OS=Mus musculus OX=10090 GN=Podnl1 PE=1 SV=3
11	P70389	5.81e-24	108	603	0.249	0.274	ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus OX=10090 GN=Igfals PE=1 SV=1
12	Q9HBX8	2.37e-23	108	967	0.201	0.138	LGR6_HUMAN Leucine-rich repeat-containing G-protein coupled receptor 6 OS=Homo sapiens OX=9606 GN=LGR6 PE=1 SV=3
13	Q149C3	2.48e-23	107	593	0.184	0.206	LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus OX=10090 GN=Lingo4 PE=2 SV=2
14	Q7KTA0	4.61e-23	107	1360	0.219	0.107	Q7KTA0_DROME Rickets OS=Drosophila melanogaster OX=7227 GN=rk PE=3 SV=1
15	Q9NDI1	9.40e-23	106	1360	0.208	0.101	Q9NDI1_DROME Glycoprotein hormone receptor II OS=Drosophila melanogaster OX=7227 GN=rk PE=2 SV=1
16	P35859	2.52e-22	103	603	0.193	0.212	ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus OX=10116 GN=Igfals PE=1 SV=1
17	Q9WVC1	4.02e-22	103	766	0.249	0.215	SLIT2_RAT Slit homolog 2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Slit2 PE=1 SV=3
18	A2ARI4	5.98e-22	103	951	0.216	0.150	LGR4_MOUSE Leucine-rich repeat-containing G-protein coupled receptor 4 OS=Mus musculus OX=10090 GN=Lgr4 PE=1 SV=1
19	O75094	1.28e-21	102	1523	0.279	0.121	SLIT3_HUMAN Slit homolog 3 protein OS=Homo sapiens OX=9606 GN=SLIT3 PE=2 SV=3
20	Q9WVB4	1.93e-21	102	1523	0.183	0.079	SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus OX=10090 GN=Slit3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01462 LRRNT	0.0067	27.3	Leucine rich repeat N-terminal domain
2	PF00560 LRR_1	6.4e-19	76.3	Leucine Rich Repeat
3	PF12799 LRR_4	4.7e-40	146.0	Leucine Rich repeats (2 copies)
4	PF13306 LRR_5	9.1e-05	33.9	BspA type Leucine rich repeat region (6 copies)
5	PF13516 LRR_6	0.095	23.9	Leucine Rich repeat
6	PF13855 LRR_8	8.5e-67	232.1	Leucine rich repeat
7	PF14580 LRR_9	0.0013	29.9	Leucine-rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384126

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221930	0.913	Transforming growth factor beta-1
2	9606.ENSP00000321573	0.772	Discoidin, CUB and LCCL domain containing 2
3	9606.ENSP00000433205	0.710	BRCA2-interacting transcriptional repressor EMSY
4	9606.ENSP00000414635	0.688	Leucine-rich repeat-containing protein 34
5	9606.ENSP00000278927	0.652	Endothelial cell-selective adhesion molecule
6	9606.ENSP00000365380	0.617	Forkhead box protein P3
7	9606.ENSP00000309538	0.584	Death-associated protein-like 1
8	9606.ENSP00000011653	0.549	T-cell surface glycoprotein CD4
9	9606.ENSP00000278980	0.547	COMM domain-containing protein 7
10	9606.ENSP00000423067	0.516	WD repeat-containing protein 36
11	9606.ENSP00000303939	0.502	Cytotoxic T-lymphocyte protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050431	0.999	transforming growth factor beta binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0009987	0.985	cellular process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0001817	0.961	regulation of cytokine production
GO:0071634	0.931	regulation of transforming growth factor beta production
GO:0048583	0.898	regulation of response to stimulus
GO:0051716	0.876	cellular response to stimulus
GO:0007165	0.807	signal transduction
GO:0048518	0.794	positive regulation of biological process
GO:0048523	0.794	negative regulation of cellular process
GO:0007166	0.746	cell surface receptor signaling pathway
GO:0023051	0.692	regulation of signaling
GO:0010646	0.691	regulation of cell communication
GO:0009719	0.564	response to endogenous stimulus
GO:0048522	0.525	positive regulation of cellular process
GO:0048856	0.505	anatomical structure development
GO:0009893	0.472	positive regulation of metabolic process
GO:0070848	0.468	response to growth factor
GO:0010604	0.443	positive regulation of macromolecule metabolic process
GO:0007178	0.397	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0032501	0.388	multicellular organismal process
GO:0048584	0.345	positive regulation of response to stimulus
GO:0009966	0.329	regulation of signal transduction
GO:0002682	0.324	regulation of immune system process
GO:0009892	0.317	negative regulation of metabolic process
GO:0071363	0.316	cellular response to growth factor stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005886	0.983	plasma membrane
GO:0009986	0.720	cell surface
GO:0005737	0.451	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]