StarFunc result for job id Q14393

User Input

>input (678 residues)
MAPSLSPGPAALRRAPQLLLLLLAAECALAALLPAREATQFLRPRQRRAFQVFEEAKQGH
LERECVEELCSREEAREVFENDPETDYFYPRYLDCINKYGSPYTKNSGFATCVQNLPDQC
TPNPCDRKGTQACQDLMGNFFCLCKAGWGGRLCDKDVNECSQENGGCLQICHNKPGSFHC
SCHSGFELSSDGRTCQDIDECADSEACGEARCKNLPGSYSCLCDEGFAYSSQEKACRDVD
ECLQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTCEDILPCVPFSVAKSVKSLYLGRM
FSGTPVIRLRFKRLQPTRLVAEFDFRTFDPEGILLFAGGHQDSTWIVLALRAGRLELQLR
YNGVGRVTSSGPVINHGMWQTISVEELARNLVIKVNRDAVMKIAVAGDLFQPERGLYHLN
LTVGGIPFHEKDLVQPINPRLDGCMRSWNWLNGEDTTIQETVKVNTRMQCFSVTERGSFY
PGSGFAFYSLDYMRTPLDVGTESTWEVEVVAHIRPAADTGVLFALWAPDLRAVPLSVALV
DYHSTKKLKKQLVVLAVEHTALALMEIKVCDGQEHVVTVSLRDGEATLEVDGTRGQSEVS
AAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAY
KHSDITAHSCPPVEPAAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14393	1.000	1.000	0.000	678	1.000	1.000	Q14393.pdb.gz	GAS6_HUMAN Growth arrest-specific protein 6 OS=Homo sapiens OX=9606 GN=GAS6 PE=1 SV=3
2	AFDB:Q61592	0.830	0.835	0.000	674	0.811	0.816	Q61592.pdb.gz	GAS6_MOUSE Growth arrest-specific protein 6 OS=Mus musculus OX=10090 GN=Gas6 PE=2 SV=2
3	AFDB:F1QGG9	0.706	0.734	1.749E-82	648	0.485	0.508	F1QGG9.pdb.gz
4	AFDB:P07225	0.693	0.695	2.295E-76	676	0.428	0.429	P07225.pdb.gz	PROS_HUMAN Vitamin K-dependent protein S OS=Homo sapiens OX=9606 GN=PROS1 PE=1 SV=1
5	AFDB:P53813	0.658	0.660	3.210E-75	675	0.413	0.415	P53813.pdb.gz	PROS_RAT Vitamin K-dependent protein S OS=Rattus norvegicus OX=10116 GN=Pros1 PE=2 SV=1
6	AFDB:A0A060WZN4	0.492	0.789	3.978E-33	412	0.146	0.240	A0A060WZN4.pdb.gz	A0A060WZN4_ONCMY Sex hormone-binding globulin beta form OS=Oncorhynchus mykiss OX=8022 GN=shbgb PE=4 SV=1
7	AFDB:Q2WFI5	0.432	0.705	6.796E-27	397	0.122	0.209	Q2WFI5.pdb.gz	Q2WFI5_ONCMY Sex hormone-binding globulin OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00051280001 PE=2 SV=1
8	AFDB:P04278	0.444	0.731	8.114E-26	402	0.125	0.211	P04278.pdb.gz	SHBG_HUMAN Sex hormone-binding globulin OS=Homo sapiens OX=9606 GN=SHBG PE=1 SV=2
9	AFDB:P08689	0.454	0.743	1.114E-25	403	0.136	0.228	P08689.pdb.gz	SHBG_RAT Sex hormone-binding globulin OS=Rattus norvegicus OX=10116 GN=Shbg PE=1 SV=1
10	AFDB:Q64HD0	0.396	0.673	7.844E-25	381	0.121	0.215	Q64HD0.pdb.gz	Q64HD0_DANRE Sex hormone-binding globulin OS=Danio rerio OX=7955 GN=shbgl PE=1 SV=1
11	PDB:6m5yA	0.159	0.358	2.345E-6	270	0.047	0.119	6m5yA.pdb.gz	Crystal structure and conformational stability of a galectin-1 tandem-repeat mutant with a short linker.
12	PDB:3v0aB	0.180	0.111	3.770E-6	1150	0.060	0.036	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
13	PDB:7q3nU	0.109	0.201	1.203E-5	292	0.093	0.216	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
14	PDB:5n0cA	0.157	0.087	1.486E-5	1293	0.055	0.029	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.
15	PDB:7tzcA	0.115	0.032	3.457E-5	4404	0.069	0.011	7tzcA.pdb.gz	A drug and ATP binding site in type 1 ryanodine receptor.
16	PDB:5i08A	0.121	0.090	6.864E-5	958	0.055	0.039	5i08A.pdb.gz
17	PDB:7tdgA	0.121	0.040	7.236E-5	4134	0.050	0.008	7tdgA.pdb.gz	Ca 2+ -inactivation of the mammalian ryanodine receptor type 1 in a lipidic environment revealed by cryo-EM.
18	PDB:3vv1A	0.148	0.549	8.041E-5	141	0.013	0.064	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
19	PDB:7qfqA	0.130	0.075	8.041E-5	1291	0.041	0.022	7qfqA.pdb.gz
20	PDB:7m6aA	0.118	0.036	9.930E-5	4306	0.080	0.013	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P07225	0.0	594	676	0.432	0.433	PROS_HUMAN Vitamin K-dependent protein S OS=Homo sapiens OX=9606 GN=PROS1 PE=1 SV=1
2	P53813	0.0	558	675	0.416	0.418	PROS_RAT Vitamin K-dependent protein S OS=Rattus norvegicus OX=10116 GN=Pros1 PE=2 SV=1
3	Q08761	0.0	559	675	0.425	0.427	PROS_MOUSE Vitamin K-dependent protein S OS=Mus musculus OX=10090 GN=Pros1 PE=2 SV=1
4	Q14393	0.0	1405	678	1.000	1.000	GAS6_HUMAN Growth arrest-specific protein 6 OS=Homo sapiens OX=9606 GN=GAS6 PE=1 SV=3
5	Q61592	0.0	1135	674	0.791	0.795	GAS6_MOUSE Growth arrest-specific protein 6 OS=Mus musculus OX=10090 GN=Gas6 PE=2 SV=2
6	Q63772	0.0	1146	674	0.802	0.807	GAS6_RAT Growth arrest-specific protein 6 OS=Rattus norvegicus OX=10116 GN=Gas6 PE=1 SV=1
7	Q7T3H4	0.0	658	648	0.491	0.514	Q7T3H4_DANRE Growth arrest-specific 6 OS=Danio rerio OX=7955 GN=fj34a12 PE=2 SV=1
8	A5JUT5	1.90e-30	126	412	0.152	0.250	A5JUT5_ONCMY Sex hormone-binding globulin beta form OS=Oncorhynchus mykiss OX=8022 GN=SHBGb PE=2 SV=1
9	A0A060WZN4	2.05e-30	126	412	0.152	0.250	A0A060WZN4_ONCMY Sex hormone-binding globulin beta form OS=Oncorhynchus mykiss OX=8022 GN=shbgb PE=4 SV=1
10	F1QLC3	5.91e-27	117	504	0.097	0.131	F1QLC3_DANRE Coagulation factor X OS=Danio rerio OX=7955 GN=fi12c10 PE=4 SV=1
11	Q9CQW3	7.23e-27	115	399	0.102	0.173	PROZ_MOUSE Vitamin K-dependent protein Z OS=Mus musculus OX=10090 GN=Proz PE=1 SV=1
12	P16296	1.54e-26	115	462	0.105	0.154	FA9_RAT Coagulation factor IX OS=Rattus norvegicus OX=10116 GN=F9 PE=2 SV=2
13	Q2WFI5	4.71e-26	113	397	0.133	0.227	Q2WFI5_ONCMY Sex hormone-binding globulin OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00051280001 PE=2 SV=1
14	Q58L96	6.21e-26	114	467	0.088	0.128	FAXC_OXYSU Venom prothrombin activator oscutarin-C catalytic subunit OS=Oxyuranus scutellatus OX=8668 PE=1 SV=1
15	Q58L95	7.12e-26	113	467	0.090	0.131	FAXC_OXYMI Venom prothrombin activator omicarin-C catalytic subunit OS=Oxyuranus microlepidotus OX=111177 PE=2 SV=1
16	Q63207	1.62e-25	112	482	0.106	0.149	FA10_RAT Coagulation factor X OS=Rattus norvegicus OX=10116 GN=F10 PE=2 SV=1
17	Q56VR3	1.76e-25	112	467	0.088	0.128	FAXC_PSETE Venom prothrombin activator pseutarin-C catalytic subunit OS=Pseudonaja textilis OX=8673 PE=1 SV=2
18	Q9VS89	3.15e-25	114	1618	0.094	0.040	Q9VS89_DROME FI18763p1 OS=Drosophila melanogaster OX=7227 GN=frac PE=2 SV=4
19	P16294	4.45e-25	111	471	0.100	0.144	FA9_MOUSE Coagulation factor IX OS=Mus musculus OX=10090 GN=F9 PE=2 SV=3
20	Q6NZL8	5.53e-25	113	1018	0.109	0.073	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	9.3e-14	62.3	Complement Clr-like EGF-like
2	PF00008 EGF	0.0014	30.2	EGF-like domain
3	PF12947 EGF_3	0.0023	29.4	EGF domain
4	PF07645 EGF_CA	1.2e-16	71.9	Calcium-binding EGF domain
5	PF14670 FXa_inhibition	1.9e-12	58.6	Coagulation Factor Xa inhibitory site
6	PF00594 Gla	5.2e-14	63.5	Vitamin K-dependent carboxylation/gamma-carboxyglutamic (GLA) domain
7	PF12661 hEGF	0.039	25.8	Human growth factor-like EGF
8	PF00054 Laminin_G_1	7.3e-23	92.6	Laminin G domain
9	PF02210 Laminin_G_2	2.7e-24	97.6	Laminin G domain
10	PF06247 Plasmod_Pvs28	7	18.3	Pvs28 EGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331831

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301178	0.999	Tyrosine-protein kinase receptor UFO
2	9606.ENSP00000295408	0.997	Tyrosine-protein kinase Mer
3	9606.ENSP00000263798	0.994	Tyrosine-protein kinase receptor TYRO3
4	9606.ENSP00000233838	0.965	Vitamin K-dependent gamma-carboxylase
5	9606.ENSP00000431418	0.962	High affinity nerve growth factor receptor
6	9606.ENSP00000483552	0.912	Furin
7	9606.ENSP00000268150	0.763	Lactadherin
8	9606.ENSP00000274532	0.743	T-cell immunoglobulin and mucin domain-containing protein 4
9	9606.ENSP00000430945	0.691	Adhesion G protein-coupled receptor B1
10	9606.ENSP00000229771	0.687	Tubby-related protein 1
11	9606.ENSP00000228938	0.654	Matrix Gla protein
12	9606.ENSP00000382941	0.649	Tyrosine-protein phosphatase non-receptor type substrate 1
13	9606.ENSP00000275493	0.592	Epidermal growth factor receptor
14	9606.ENSP00000451828	0.577	RAC-alpha serine/threonine-protein kinase
15	9606.ENSP00000230538	0.556	Laminin subunit alpha-4
16	9606.ENSP00000265334	0.549	Cyclin-dependent kinase-like 3
17	9606.ENSP00000260408	0.548	Disintegrin and metalloproteinase domain-containing protein 10
18	9606.ENSP00000362680	0.543	Proto-oncogene tyrosine-protein kinase Src
19	9606.ENSP00000252575	0.540	Neurocan core protein
20	9606.ENSP00000329418	0.537	Suppressor of cytokine signaling 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	1.000	receptor ligand activity
GO:0030234	0.989	enzyme regulator activity
GO:0140678	0.967	molecular function inhibitor activity
GO:0061134	0.954	peptidase regulator activity
GO:0019899	0.939	enzyme binding
GO:0004857	0.911	enzyme inhibitor activity
GO:0061135	0.908	endopeptidase regulator activity
GO:0030414	0.901	peptidase inhibitor activity
GO:0004866	0.883	endopeptidase inhibitor activity
GO:0019900	0.855	kinase binding
GO:0030971	0.846	receptor tyrosine kinase binding
GO:0030295	0.811	protein kinase activator activity
GO:0008289	0.787	lipid binding
GO:0030296	0.780	protein tyrosine kinase activator activity
GO:0044877	0.508	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.990	cellular response to stimulus
GO:0050794	0.990	regulation of cellular process
GO:0048518	0.989	positive regulation of biological process
GO:0007154	0.987	cell communication
GO:0019222	0.986	regulation of metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0048519	0.981	negative regulation of biological process
GO:0023052	0.978	signaling
GO:0051239	0.974	regulation of multicellular organismal process
GO:0007165	0.974	signal transduction
GO:0048583	0.973	regulation of response to stimulus
GO:0065009	0.970	regulation of molecular function
GO:0080090	0.969	regulation of primary metabolic process
GO:0051171	0.969	regulation of nitrogen compound metabolic process
GO:0048522	0.968	positive regulation of cellular process
GO:0032501	0.966	multicellular organismal process
GO:0048523	0.963	negative regulation of cellular process
GO:0051246	0.962	regulation of protein metabolic process
GO:0032502	0.955	developmental process
GO:0023051	0.938	regulation of signaling
GO:0031323	0.936	regulation of cellular metabolic process
GO:0048856	0.935	anatomical structure development
GO:0010646	0.935	regulation of cell communication
GO:0051241	0.929	negative regulation of multicellular organismal process
GO:0050790	0.897	regulation of catalytic activity
GO:0051247	0.889	positive regulation of protein metabolic process
GO:0009966	0.880	regulation of signal transduction
GO:0051174	0.879	regulation of phosphorus metabolic process
GO:0010468	0.873	regulation of gene expression
GO:0009892	0.870	negative regulation of metabolic process
GO:0043491	0.870	protein kinase B signaling
GO:0030335	0.866	positive regulation of cell migration
GO:0048584	0.864	positive regulation of response to stimulus
GO:0042327	0.858	positive regulation of phosphorylation
GO:0032879	0.850	regulation of localization
GO:1902533	0.847	positive regulation of intracellular signal transduction
GO:0010605	0.841	negative regulation of macromolecule metabolic process
GO:0002684	0.837	positive regulation of immune system process
GO:0045859	0.827	regulation of protein kinase activity
GO:0033674	0.827	positive regulation of kinase activity
GO:0006950	0.822	response to stress
GO:0001934	0.818	positive regulation of protein phosphorylation
GO:0048869	0.815	cellular developmental process
GO:0051172	0.811	negative regulation of nitrogen compound metabolic process
GO:0007166	0.808	cell surface receptor signaling pathway
GO:0016043	0.807	cellular component organization
GO:0030154	0.806	cell differentiation
GO:0045860	0.797	positive regulation of protein kinase activity
GO:0051234	0.785	establishment of localization
GO:0043066	0.783	negative regulation of apoptotic process
GO:0051896	0.781	regulation of protein kinase B signaling
GO:0065008	0.780	regulation of biological quality
GO:0051240	0.779	positive regulation of multicellular organismal process
GO:0042127	0.776	regulation of cell population proliferation
GO:0050793	0.773	regulation of developmental process
GO:0006810	0.771	transport
GO:0048468	0.768	cell development
GO:0042221	0.757	response to chemical
GO:0060627	0.751	regulation of vesicle-mediated transport
GO:0051336	0.747	regulation of hydrolase activity
GO:0051248	0.742	negative regulation of protein metabolic process
GO:0051050	0.730	positive regulation of transport
GO:0030162	0.726	regulation of proteolysis
GO:0016477	0.720	cell migration
GO:0048585	0.716	negative regulation of response to stimulus
GO:0010033	0.703	response to organic substance
GO:0070887	0.702	cellular response to chemical stimulus
GO:0050878	0.696	regulation of body fluid levels
GO:0080134	0.686	regulation of response to stress
GO:0032101	0.686	regulation of response to external stimulus
GO:0051897	0.685	positive regulation of protein kinase B signaling
GO:0009889	0.682	regulation of biosynthetic process
GO:0009611	0.672	response to wounding
GO:0009605	0.671	response to external stimulus
GO:0009968	0.670	negative regulation of signal transduction
GO:0050730	0.648	regulation of peptidyl-tyrosine phosphorylation
GO:0010629	0.608	negative regulation of gene expression
GO:1901700	0.588	response to oxygen-containing compound
GO:0008152	0.579	metabolic process
GO:0071704	0.572	organic substance metabolic process
GO:0031326	0.565	regulation of cellular biosynthetic process
GO:0044238	0.552	primary metabolic process
GO:0071310	0.542	cellular response to organic substance
GO:0006807	0.515	nitrogen compound metabolic process
GO:2000026	0.510	regulation of multicellular organismal development
GO:0007275	0.503	multicellular organism development
GO:0008284	0.497	positive regulation of cell population proliferation
GO:0044419	0.489	biological process involved in interspecies interaction between organisms
GO:0044237	0.467	cellular metabolic process
GO:0016192	0.459	vesicle-mediated transport
GO:0048731	0.459	system development
GO:0043170	0.443	macromolecule metabolic process
GO:0010556	0.442	regulation of macromolecule biosynthetic process
GO:1901564	0.413	organonitrogen compound metabolic process
GO:0019219	0.413	regulation of nucleobase-containing compound metabolic process
GO:0051094	0.409	positive regulation of developmental process
GO:0019538	0.387	protein metabolic process
GO:0051128	0.345	regulation of cellular component organization
GO:0045595	0.327	regulation of cell differentiation
GO:0006355	0.322	regulation of DNA-templated transcription
GO:0009719	0.311	response to endogenous stimulus
GO:0036211	0.305	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043227	0.997	membrane-bounded organelle
GO:0012505	0.993	endomembrane system
GO:0031982	0.983	vesicle
GO:0070013	0.980	intracellular organelle lumen
GO:0071944	0.974	cell periphery
GO:0005737	0.970	cytoplasm
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0070062	0.865	extracellular exosome
GO:0031410	0.851	cytoplasmic vesicle
GO:0016020	0.846	membrane
GO:0005886	0.739	plasma membrane
GO:0030141	0.333	secretory granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]