StarFunc result for job id Q14406

User Input

>input (222 residues)
MAAGSRTSLLLAFALLCLPWLQEAGAVQTVPLSRLFKEAMLQAHRAHQLAIDTYQEFISS
WGMEAYITKEQKYSFLHDSQTSFCFSDSIPTSSNMEETQQKSNLELLHISLLLIESRLEP
VRFLRSTFTNNLVYDTSDSDDYHLLKDLEEGIQMLMGRLEDGSHLTGQTLKQTYSKFDTN
SHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSVEGSCGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0DML2	0.847	0.865	2.134E-23	217	0.901	0.922	P0DML2.pdb.gz	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
2	AFDB:P01241	0.820	0.837	1.491E-21	217	0.793	0.811	P01241.pdb.gz	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
3	PDB:1z7cA	0.625	0.846	3.422E-15	161	0.662	0.913	1z7cA.pdb.gz
4	AFDB:A0FJ27	0.722	0.736	1.111E-14	217	0.563	0.576	A0FJ27.pdb.gz	A0FJ27_SHEEP Growth hormone OS=Ovis aries OX=9940 PE=2 SV=1
5	AFDB:P01244	0.754	0.774	1.229E-14	216	0.568	0.583	P01244.pdb.gz	SOMA_RAT Somatotropin OS=Rattus norvegicus OX=10116 GN=Gh1 PE=1 SV=1
6	PDB:1bp3A	0.696	0.817	3.008E-14	186	0.667	0.796	1bp3A.pdb.gz	The X-ray structure of a growth hormone-prolactin receptor complex.
7	AFDB:H6ULW9	0.743	0.762	1.076E-11	216	0.437	0.449	H6ULW9.pdb.gz	H6ULW9_CHICK Growth hormone OS=Gallus gallus OX=9031 GN=GH PE=3 SV=1
8	PDB:1huwA	0.622	0.808	2.151E-11	166	0.545	0.729	1huwA.pdb.gz
9	AFDB:Q1JQ34	0.639	0.671	7.115E-8	210	0.306	0.324	Q1JQ34.pdb.gz	Q1JQ34_DANRE Growth hormone 1 OS=Danio rerio OX=7955 GN=ghl PE=2 SV=1
10	AFDB:B2Z9Z2	0.624	0.656	3.588E-7	210	0.297	0.314	B2Z9Z2.pdb.gz	B2Z9Z2_SALSA Growth hormone 2 OS=Salmo salar OX=8030 GN=LOC106607462 PE=3 SV=1
11	AFDB:A7LFX3	0.624	0.686	8.473E-7	200	0.297	0.330	A7LFX3.pdb.gz	A7LFX3_ICTPU Growth hormone OS=Ictalurus punctatus OX=7998 GN=gh1 PE=2 SV=1
12	AFDB:P09321	0.629	0.631	9.375E-7	221	0.243	0.244	P09321.pdb.gz	PR3B1_RAT Prolactin-3B1 OS=Rattus norvegicus OX=10116 GN=Prl3b1 PE=2 SV=2
13	AFDB:W5PGF7	0.640	0.599	1.720E-6	239	0.248	0.230	W5PGF7.pdb.gz	W5PGF7_SHEEP Placental lactogen OS=Ovis aries OX=9940 GN=LOC443319 PE=3 SV=1
14	PDB:1rw5A	0.608	0.672	3.179E-5	199	0.203	0.226	1rw5A.pdb.gz
15	PDB:1f6fA	0.611	0.730	1.449E-4	183	0.189	0.230	1f6fA.pdb.gz
16	PDB:3d48P	0.557	0.735	2.795E-4	165	0.180	0.242	3d48P.pdb.gz	Crystal structure of a prolactin receptor antagonist bound to the extracellular domain of the prolactin receptor
17	PDB:7zxkC	0.388	0.490	3.583E-2	166	0.131	0.175	7zxkC.pdb.gz
18	PDB:7u7nD	0.492	0.559	5.369E-2	191	0.126	0.147	7u7nD.pdb.gz
19	PDB:7z0lB	0.452	0.299	8.045E-2	370	0.131	0.078	7z0lB.pdb.gz
20	PDB:3hmxB	0.279	0.329	3.666E-1	176	0.135	0.170	3hmxB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0DML3	1.65e-127	360	217	0.905	0.926	CSH2_HUMAN Chorionic somatomammotropin hormone 2 OS=Homo sapiens OX=9606 GN=CSH2 PE=1 SV=1
2	P0DML2	7.90e-127	358	217	0.901	0.922	CSH1_HUMAN Chorionic somatomammotropin hormone 1 OS=Homo sapiens OX=9606 GN=CSH1 PE=1 SV=1
3	P01241	9.29e-110	315	217	0.793	0.811	SOMA_HUMAN Somatotropin OS=Homo sapiens OX=9606 GN=GH1 PE=1 SV=2
4	P01242	1.16e-99	290	217	0.748	0.765	SOM2_HUMAN Growth hormone variant OS=Homo sapiens OX=9606 GN=GH2 PE=1 SV=3
5	P01248	6.10e-78	235	216	0.595	0.611	SOMA_PIG Somatotropin OS=Sus scrofa OX=9823 GN=GH1 PE=1 SV=2
6	P06880	3.40e-74	225	216	0.568	0.583	SOMA_MOUSE Somatotropin OS=Mus musculus OX=10090 GN=Gh1 PE=2 SV=1
7	P01244	8.51e-74	224	216	0.568	0.583	SOMA_RAT Somatotropin OS=Rattus norvegicus OX=10116 GN=Gh1 PE=1 SV=1
8	G3CI04	1.04e-72	221	217	0.572	0.585	G3CI04_SHEEP Growth hormone OS=Ovis aries OX=9940 PE=2 SV=1
9	Q0QBC4	2.42e-70	216	217	0.563	0.576	Q0QBC4_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
10	I6WN98	2.02e-66	206	216	0.586	0.602	I6WN98_BOVIN Somatotropin OS=Bos taurus OX=9913 GN=Gh1 PE=3 SV=1
11	B0FPG6	4.05e-66	205	217	0.586	0.599	B0FPG6_BOVIN Growth hormone OS=Bos taurus OX=9913 GN=GH PE=2 SV=1
12	P01246	4.05e-66	205	217	0.586	0.599	SOMA_BOVIN Somatotropin OS=Bos taurus OX=9913 GN=GH1 PE=1 SV=1
13	B0FPG4	8.51e-66	204	217	0.581	0.594	B0FPG4_BOVIN Growth hormone OS=Bos taurus OX=9913 GN=GH1 PE=3 SV=1
14	Q0QBC6	5.60e-65	202	217	0.577	0.590	Q0QBC6_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
15	A4GX95	8.66e-65	201	217	0.577	0.590	A4GX95_BOVIN Growth hormone OS=Bos taurus OX=9913 PE=2 SV=1
16	P67930	8.66e-65	201	217	0.577	0.590	SOMA_SHEEP Somatotropin OS=Ovis aries OX=9940 GN=GH1 PE=1 SV=1
17	Q71VP3	8.66e-65	201	217	0.577	0.590	Q71VP3_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=2 SV=1
18	Q95205	1.11e-64	201	204	0.527	0.574	Q95205_SHEEP Placental growth hormone (Fragment) OS=Ovis aries OX=9940 PE=2 SV=1
19	Q0QBF7	1.76e-64	201	217	0.577	0.590	Q0QBF7_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1
20	Q0QBG3	2.07e-64	201	217	0.577	0.590	Q0QBG3_SHEEP Growth hormone OS=Ovis aries OX=9940 GN=GH PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00103 Hormone_1	1.2e-47	174.0	Somatotropin hormone family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000309524

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360464	0.801	NF-kappa-B-activating protein
2	9606.ENSP00000316416	0.561	Chorionic somatomammotropin hormone 1
3	9606.ENSP00000384092	0.509	Pro-opiomelanocortin
4	9606.ENSP00000257600	0.505	E3 ubiquitin-protein ligase DTX1
5	9606.ENSP00000482232	0.505	Glycoprotein hormones, alpha polypeptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0005126	0.966	cytokine receptor binding
GO:0051427	0.933	hormone receptor binding
GO:0005131	0.913	growth hormone receptor binding
GO:0030545	0.887	signaling receptor regulator activity
GO:0048018	0.880	receptor ligand activity
GO:0005179	0.446	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0048518	0.980	positive regulation of biological process
GO:0009987	0.967	cellular process
GO:0019222	0.955	regulation of metabolic process
GO:0048522	0.934	positive regulation of cellular process
GO:0009893	0.930	positive regulation of metabolic process
GO:0031323	0.902	regulation of cellular metabolic process
GO:0080090	0.789	regulation of primary metabolic process
GO:0031325	0.778	positive regulation of cellular metabolic process
GO:0060255	0.756	regulation of macromolecule metabolic process
GO:0051171	0.748	regulation of nitrogen compound metabolic process
GO:0032412	0.740	regulation of monoatomic ion transmembrane transporter activity
GO:1904062	0.739	regulation of monoatomic cation transmembrane transport
GO:0051716	0.734	cellular response to stimulus
GO:0010959	0.733	regulation of metal ion transport
GO:0023052	0.729	signaling
GO:0007154	0.728	cell communication
GO:0007165	0.696	signal transduction
GO:1902305	0.692	regulation of sodium ion transmembrane transport
GO:1904064	0.654	positive regulation of cation transmembrane transport
GO:0032414	0.638	positive regulation of ion transmembrane transporter activity
GO:0006950	0.607	response to stress
GO:0010646	0.593	regulation of cell communication
GO:0023051	0.591	regulation of signaling
GO:1902307	0.512	positive regulation of sodium ion transmembrane transport
GO:0009628	0.483	response to abiotic stimulus
GO:0010604	0.478	positive regulation of macromolecule metabolic process
GO:0010562	0.460	positive regulation of phosphorus metabolic process
GO:0019220	0.450	regulation of phosphate metabolic process
GO:0051173	0.448	positive regulation of nitrogen compound metabolic process
GO:0042221	0.441	response to chemical
GO:0048519	0.430	negative regulation of biological process
GO:0032501	0.411	multicellular organismal process
GO:0048523	0.393	negative regulation of cellular process
GO:0009889	0.376	regulation of biosynthetic process
GO:0042327	0.361	positive regulation of phosphorylation
GO:0043266	0.349	regulation of potassium ion transport
GO:2000651	0.336	positive regulation of sodium ion transmembrane transporter activity
GO:0031399	0.335	regulation of protein modification process
GO:2000377	0.316	regulation of reactive oxygen species metabolic process
GO:0010468	0.313	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0043226	0.996	organelle
GO:0043227	0.994	membrane-bounded organelle
GO:0070013	0.991	intracellular organelle lumen
GO:0012505	0.990	endomembrane system
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005737	0.980	cytoplasm
GO:0031410	0.891	cytoplasmic vesicle
GO:0005615	0.865	extracellular space
GO:0031904	0.419	endosome lumen
GO:0031981	0.340	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]