StarFunc result for job id Q14409

User Input

>input (553 residues)
MAASKKAVLGPLVGAVDQGTSSTRFLVFNSRTAELLSHHQVEIKQEFPREGWVEQDPKEI
LHSVYECIEKTCEKLGQLNIGISNIKAIGVSNQRETTVVWDKITGEPLYNAVVWLDLRTQ
STVESLSKRIPGNNNFVKSKTGLPLSTYFSAVKLRWLLDNVRKVQKAVEEKRALFGTIDS
WLIWSLTGGVNGGVHCTDVTNASRTMLFNIHSLEWDKQLCEFFGIPMEILPHVRSSSEIY
GLMKAGALEGVPISGCLGDQSAALVGQMCFQIGQAKNTYGTGCFLLCNTGHKCVFSDHGL
LTTVAYKLGRDKPVYYALEGSVAIAGAVIRWLRDNLGIIKTSEEIEKLAKEVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTSNKILMQLQADILYIPVVKPLMPETTALGAAMAAGAAEGVDVWSLEPEDLS
AVTMERFEPQINAEESEIRYSTWKKAVMKSMGWVTTQSPEGGDPSVFCSLPLGFFIVSSM
AMLIGARYISGIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P32189	0.958	0.947	0.000	559	0.984	0.973	P32189.pdb.gz	GLPK_HUMAN Glycerol kinase OS=Homo sapiens OX=9606 GN=GK PE=1 SV=3
2	AFDB:Q14410	0.930	0.930	0.000	553	0.877	0.877	Q14410.pdb.gz	GLPK2_HUMAN Glycerol kinase 2 OS=Homo sapiens OX=9606 GN=GK2 PE=1 SV=2
3	AFDB:Q9WU65	0.952	0.951	0.000	554	0.839	0.838	Q9WU65.pdb.gz	GLPK2_MOUSE Glycerol kinase 2 OS=Mus musculus OX=10090 GN=Gk2 PE=1 SV=1
4	AFDB:Q0VDQ2	0.878	0.884	1.586E-103	549	0.812	0.818	Q0VDQ2.pdb.gz	Q0VDQ2_MOUSE glycerol kinase OS=Mus musculus OX=10090 GN=Gykl1 PE=2 SV=1
5	AFDB:Q9W0U0	0.890	0.914	9.506E-78	538	0.505	0.519	Q9W0U0.pdb.gz	Q9W0U0_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk1 PE=1 SV=1
6	AFDB:Q961K9	0.890	0.856	2.405E-77	576	0.468	0.450	Q961K9.pdb.gz	Q961K9_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk2 PE=2 SV=1
7	AFDB:Q9M8L4	0.885	0.937	2.906E-73	522	0.467	0.494	Q9M8L4.pdb.gz	GLPK_ARATH Glycerol kinase OS=Arabidopsis thaliana OX=3702 GN=GLPK PE=1 SV=1
8	AFDB:Q5B1J1	0.864	0.844	2.684E-71	567	0.465	0.453	Q5B1J1.pdb.gz	Q5B1J1_EMENI glycerol kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05589 PE=3 SV=1
9	AFDB:Q9NJP9	0.865	0.933	1.387E-69	512	0.439	0.475	Q9NJP9.pdb.gz	GLPK_TRYBB Glycerol kinase, glycosomal OS=Trypanosoma brucei brucei OX=5702 GN=GK PE=1 SV=1
10	AFDB:P0A6F3	0.861	0.946	1.057E-68	502	0.432	0.476	P0A6F3.pdb.gz	GLPK_ECOLI Glycerol kinase OS=Escherichia coli (strain K12) OX=83333 GN=glpK PE=1 SV=2
11	PDB:1bu6Y	0.859	0.949	1.170E-61	499	0.430	0.477	1bu6Y.pdb.gz	Glycerol kinase from Escherichia coli and an Ala65-->Thr mutant: the crystal structures reveal conformational changes with implications for allosteric regulation.
12	PDB:2itmA	0.697	0.798	3.759E-32	476	0.190	0.221	2itmA.pdb.gz	Structural and kinetic studies of induced fit in xylulose kinase from Escherichia coli.
13	PDB:5ya0A	0.684	0.778	4.741E-32	480	0.217	0.250	5ya0A.pdb.gz
14	PDB:2cgjA	0.698	0.796	2.734E-24	479	0.156	0.180	2cgjA.pdb.gz	Structure and Reaction Mechanism of L-Rhamnulose Kinase from Escherichia Coli.
15	PDB:4bc2A	0.602	0.626	5.921E-23	528	0.150	0.157	4bc2A.pdb.gz	Structure and Function of Human Xylulokinase, an Enzyme with Important Roles in Carbohydrate Metabolism
16	PDB:5htvA	0.565	0.706	1.259E-22	424	0.152	0.198	5htvA.pdb.gz	Crystal Structures of Putative Sugar Kinases from Synechococcus Elongatus PCC 7942 and Arabidopsis Thaliana
17	PDB:5huxA	0.572	0.709	5.050E-19	429	0.154	0.198	5huxA.pdb.gz	Crystal Structures of Putative Sugar Kinases from Synechococcus Elongatus PCC 7942 and Arabidopsis Thaliana
18	PDB:4a2bA	0.328	0.445	4.188E-7	386	0.107	0.153	4a2bA.pdb.gz	Ftsa Forms Actin-Like Protofilaments
19	PDB:3wquB	0.333	0.467	1.336E-6	371	0.098	0.146	3wquB.pdb.gz	Crystal structure of FtsA from Staphylococcus aureus
20	PDB:3slcA	0.271	0.352	2.530E-6	401	0.110	0.152	3slcA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P32189	0.0	1124	559	0.986	0.975	GLPK_HUMAN Glycerol kinase OS=Homo sapiens OX=9606 GN=GK PE=1 SV=3
2	Q0VDQ2	0.0	960	549	0.812	0.818	Q0VDQ2_MOUSE glycerol kinase OS=Mus musculus OX=10090 GN=Gykl1 PE=2 SV=1
3	Q14410	0.0	999	553	0.877	0.877	GLPK2_HUMAN Glycerol kinase 2 OS=Homo sapiens OX=9606 GN=GK2 PE=1 SV=2
4	Q63060	0.0	1018	524	0.910	0.960	GLPK_RAT Glycerol kinase OS=Rattus norvegicus OX=10116 GN=Gk PE=2 SV=1
5	Q64516	0.0	1102	559	0.960	0.950	GLPK_MOUSE Glycerol kinase OS=Mus musculus OX=10090 GN=Gk PE=1 SV=2
6	Q8C635	0.0	960	549	0.812	0.818	Q8C635_MOUSE glycerol kinase OS=Mus musculus OX=10090 GN=Gykl1 PE=1 SV=1
7	Q961K9	0.0	538	576	0.474	0.455	Q961K9_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk2 PE=2 SV=1
8	Q9W095	0.0	538	576	0.474	0.455	Q9W095_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk2 PE=2 SV=2
9	Q9W0U0	0.0	573	538	0.503	0.517	Q9W0U0_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk1 PE=1 SV=1
10	Q9WU64	0.0	961	549	0.814	0.820	Q9WU64_MOUSE glycerol kinase OS=Mus musculus OX=10090 GN=Gykl1 PE=2 SV=1
11	Q9WU65	0.0	954	554	0.839	0.838	GLPK2_MOUSE Glycerol kinase 2 OS=Mus musculus OX=10090 GN=Gk2 PE=1 SV=1
12	Q8IRJ9	4.06e-178	512	474	0.458	0.534	Q8IRJ9_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk1 PE=1 SV=1
13	Q8IGQ5	7.90e-178	511	474	0.456	0.532	Q8IGQ5_DROME glycerol kinase OS=Drosophila melanogaster OX=7227 GN=Gk1 PE=2 SV=1
14	Q9M8L4	5.61e-169	491	522	0.434	0.460	GLPK_ARATH Glycerol kinase OS=Arabidopsis thaliana OX=3702 GN=GLPK PE=1 SV=1
15	Q5B1J1	4.11e-160	470	567	0.470	0.459	Q5B1J1_EMENI glycerol kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05589 PE=3 SV=1
16	P0A6F3	1.86e-158	463	502	0.441	0.486	GLPK_ECOLI Glycerol kinase OS=Escherichia coli (strain K12) OX=83333 GN=glpK PE=1 SV=2
17	Q9NJP9	6.11e-154	452	512	0.434	0.469	GLPK_TRYBB Glycerol kinase, glycosomal OS=Trypanosoma brucei brucei OX=5702 GN=GK PE=1 SV=1
18	O51257	2.61e-142	422	501	0.414	0.457	GLPK_BORBU Glycerol kinase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=glpK PE=3 SV=1
19	P32190	1.01e-116	363	709	0.418	0.326	GLPK_YEAST Glycerol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GUT1 PE=1 SV=1
20	P09099	1.29e-16	85.1	484	0.177	0.202	XYLB_ECOLI Xylulose kinase OS=Escherichia coli (strain K12) OX=83333 GN=xylB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02782 FGGY_C	1.2e-57	206.5	FGGY family of carbohydrate kinases, C-terminal domain
2	PF00370 FGGY_N	7.2e-88	305.9	FGGY family of carbohydrate kinases, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000060181

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000044968	0.977	Glycerol-3-phosphate dehydrogenase 2 (Mitochondrial)
2	9598.ENSPTRP00000008412	0.937	Glycerol-3-phosphate dehydrogenase 1 (soluble)
3	9598.ENSPTRP00000001168	0.919	Aldo-keto reductase family 1, member A1 (Aldehyde reductase)
4	9598.ENSPTRP00000033770	0.919	Aldo-keto reductase family 1, member B1 (Aldose reductase)
5	9598.ENSPTRP00000033774	0.919	Aldo-keto reductase family 1, member B10 (aldose reductase)
6	9598.ENSPTRP00000058399	0.919	Aldo-keto reductase family 1, member B15
7	9598.ENSPTRP00000027892	0.909	Uncharacterized protein
8	9598.ENSPTRP00000051833	0.909	Uncharacterized protein
9	9598.ENSPTRP00000005189	0.908	Glycerol-3-phosphate acyltransferase, mitochondrial
10	9598.ENSPTRP00000034579	0.908	Uncharacterized protein
11	9598.ENSPTRP00000040915	0.836	Glycerol kinase 2
12	9598.ENSPTRP00000053176	0.694	Uncharacterized protein
13	9598.ENSPTRP00000010840	0.638	Proteasome subunit alpha type
14	9598.ENSPTRP00000026037	0.632	Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 6
15	9598.ENSPTRP00000015526	0.627	Pan troglodytes proteasome (prosome, macropain) 26S subunit, non-ATPase, 3 (PSMD3), mRNA
16	9598.ENSPTRP00000040314	0.604	Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 12
17	9598.ENSPTRP00000022265	0.603	Pan troglodytes proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 (PSMD1), mRNA
18	9598.ENSPTRP00000061079	0.603	Voltage-dependent anion channel 2
19	9598.ENSPTRP00000002183	0.599	Uncharacterized protein
20	9598.ENSPTRP00000026991	0.599	Proteasome (Prosome, macropain) 26S subunit, non-ATPase, 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0016301	1.000	kinase activity
GO:0004370	0.992	glycerol kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.981	primary metabolic process
GO:0005975	0.944	carbohydrate metabolic process
GO:1901615	0.914	organic hydroxy compound metabolic process
GO:0044281	0.860	small molecule metabolic process
GO:0019400	0.848	alditol metabolic process
GO:0006071	0.828	glycerol metabolic process
GO:0065007	0.495	biological regulation
GO:0050789	0.463	regulation of biological process
GO:1901576	0.442	organic substance biosynthetic process
GO:0006793	0.425	phosphorus metabolic process
GO:0006796	0.407	phosphate-containing compound metabolic process
GO:0050794	0.374	regulation of cellular process
GO:0050896	0.366	response to stimulus
GO:0019637	0.334	organophosphate metabolic process
GO:1901135	0.300	carbohydrate derivative metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005739	0.988	mitochondrion
GO:0005634	0.905	nucleus
GO:0016020	0.863	membrane
GO:0005829	0.803	cytosol
GO:0065010	0.638	extracellular membrane-bounded organelle
GO:0070062	0.619	extracellular exosome
GO:0012505	0.393	endomembrane system
GO:0070013	0.374	intracellular organelle lumen
GO:0031981	0.341	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:21644	0.992	ATP + glycerol = ADP + H(+) + sn-glycerol 3-phosphate
EC:2.7.1.30	0.992	glycerol kinase.

[back to server]