StarFunc result for job id Q14432

User Input

>input (1141 residues)
MAVPGDAARVRDKPVHSGVSQAPTAGRDCHHRADPASPRDSGCRGCWGDLVLQPLRSSRK
LSSALCAGSLSFLLALLVRLVRGEVGCDLEQCKEAAAAEEEEAAPGAEGGVFPGPRGGAP
GGGARLSPWLQPSALLFSLLCAFFWMGLYLLRAGVRLPLAVALLAACCGGEALVQIGLGV
GEDHLLSLPAAGVVLSCLAAATWLVLRLRLGVLMIALTSAVRTVSLISLERFKVAWRPYL
AYLAGVLGILLARYVEQILPQSAEAAPREHLGSQLIAGTKEDIPVFKRRRRSSSVVSAEM
SGCSSKSHRRTSLPCIPREQLMGHSEWDHKRGPRGSQSSGTSITVDIAVMGEAHGLITDL
LADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSDSEESSEKDKLA
IPKRLRRSLPPGLLRRVSSTWTTTTSATGLPTLEPAPVRRDRSTSIKLQEAPSSSPDSWN
NPVMMTLTKSRSFTSSYAISAANHVKAKKQSRPGALAKISPLSSPCSSPLQGTPASSLVS
KISAVQFPESADTTAKQSLGSHRALTYTQSAPDLSPQILTPPVICSSCGRPYSQGNPADE
PLERSGVATRTPSRTDDTAQVTSDYETNNNSDSSDIVQNEDETECLREPLRKASACSTYA
PETMMFLDKPILAPEPLVMDNLDSIMEQLNTWNFPIFDLVENIGRKCGRILSQVSYRLFE
DMGLFEAFKIPIREFMNYFHALEIGYRDIPYHNRIHATDVLHAVWYLTTQPIPGLSTVIN
DHGSTSDSDSDSGFTHGHMGYVFSKTYNVTDDKYGCLSGNIPALELMALYVAAAMHDYDH
PGRTNAFLVATSAPQAVLYNDRSVLENHHAAAAWNLFMSRPEYNFLINLDHVEFKHFRFL
VIEAILATDLKKHFDFVAKFNGKVNDDVGIDWTNENDRLLVCQMCIKLADINGPAKCKEL
HLQWTDGIVNEFYEQGDEEASLGLPISPFMDRSAPQLANLQESFISHIVGPLCNSYDSAG
LMPGKWVEDSDESGDTDDPEEEEEEAPAPNEEETCENNESPKKKTFKRRKIYCQITQHLL
QNHKMWKKVIEEEQRLAGIENQSLDQTPQSHSSEQIQAIKEEEEEKGKPRGEEIPTQKPD
Q

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14432	1.000	1.000	0.000	1141	1.000	1.000	Q14432.pdb.gz	PDE3A_HUMAN cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3
2	AFDB:Q62865	0.496	0.496	0.000	1141	0.845	0.845	Q62865.pdb.gz	PDE3A_RAT cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Rattus norvegicus OX=10116 GN=Pde3a PE=1 SV=1
3	PDB:4y86B	0.239	0.809	1.833E-16	326	0.075	0.264	4y86B.pdb.gz	Structural Asymmetry of Phosphodiesterase-9A and a Unique Pocket for Selective Binding of a Potent Enantiomeric Inhibitor.
4	PDB:6mzbB	0.253	0.354	9.966E-12	807	0.076	0.108	6mzbB.pdb.gz	Cryo-EM structure of phosphodiesterase 6 reveals insights into the allosteric regulation of type I phosphodiesterases.
5	PDB:7jsnA	0.253	0.346	1.230E-11	820	0.074	0.104	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
6	PDB:3bjcA	0.216	0.743	4.999E-10	311	0.059	0.215	3bjcA.pdb.gz	An insight into the pharmacophores of phosphodiesterase-5 inhibitors from synthetic and crystal structural studies
7	AFDB:Q38B85	0.078	0.084	1.355E-4	973	0.095	0.111	Q38B85.pdb.gz	Q38B85_TRYB2 TPR-repeat-containing chaperone protein DNAJ, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.1950 PE=4 SV=1
8	AFDB:E7EZE5	0.053	0.050	8.284E-4	1252	0.102	0.093	E7EZE5.pdb.gz	E7EZE5_DANRE IQ motif and SEC7 domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=iqsec1b PE=1 SV=1
9	AFDB:X1WE18	0.059	0.059	7.395E-3	1085	0.124	0.131	X1WE18.pdb.gz	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
10	AFDB:Q99959	0.063	0.076	8.045E-3	881	0.083	0.108	Q99959.pdb.gz	PKP2_HUMAN Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2 PE=1 SV=2
11	AFDB:Q9SE97	0.055	0.059	7.491E-2	1051	0.131	0.143	Q9SE97.pdb.gz	FH1_ARATH Formin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FH1 PE=1 SV=1
12	AFDB:Q80U58	0.059	0.062	8.864E-2	1066	0.112	0.120	Q80U58.pdb.gz	PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus OX=10090 GN=Pum2 PE=1 SV=2
13	AFDB:O14340	0.043	0.039	1.598E-1	1310	0.082	0.072	O14340.pdb.gz	YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2F12.05c PE=1 SV=2
14	AFDB:F4HWC3	0.044	0.038	3.269E-1	1364	0.120	0.100	F4HWC3.pdb.gz	F4HWC3_ARATH Calponin-like domain protein OS=Arabidopsis thaliana OX=3702 GN=At1g20970 PE=1 SV=1
15	PDB:4yzeA	0.048	0.156	1.676	193	0.024	0.140	4yzeA.pdb.gz
16	PDB:3aqbD	0.077	0.178	2.158	325	0.032	0.114	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
17	PDB:4efcA	0.051	0.093	2.251	452	0.039	0.097	4efcA.pdb.gz	Crystal Structure of Adenylosuccinate Lyase from Trypanosoma Brucei, Tb427tmp.160.5560
18	PDB:7bw0R	0.064	0.166	2.897	280	0.036	0.146	7bw0R.pdb.gz
19	PDB:4okmA	0.076	0.172	3.152	346	0.036	0.118	4okmA.pdb.gz	Induced-fit mechanism in class i terpene cyclases.
20	PDB:6swy8	0.055	0.133	3.152	325	0.020	0.071	6swy8.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q13370	0.0	778	1112	0.426	0.437	PDE3B_HUMAN cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B OS=Homo sapiens OX=9606 GN=PDE3B PE=1 SV=2
2	Q14432	0.0	2360	1141	1.000	1.000	PDE3A_HUMAN cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3
3	Q61409	0.0	724	1100	0.405	0.420	PDE3B_MOUSE cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B OS=Mus musculus OX=10090 GN=Pde3b PE=1 SV=2
4	Q62865	0.0	1669	1141	0.847	0.847	PDE3A_RAT cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Rattus norvegicus OX=10116 GN=Pde3a PE=1 SV=1
5	Q63085	0.0	712	1108	0.399	0.411	PDE3B_RAT cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B OS=Rattus norvegicus OX=10116 GN=Pde3b PE=1 SV=1
6	Q9Z0X4	0.0	1666	1141	0.839	0.839	PDE3A_MOUSE cGMP-inhibited 3',5'-cyclic phosphodiesterase 3A OS=Mus musculus OX=10090 GN=Pde3a PE=1 SV=1
7	Q8I0P7	1.22e-95	322	678	0.142	0.239	PDE3_CAEEL Probable 3',5'-cyclic phosphodiesterase pde-3 OS=Caenorhabditis elegans OX=6239 GN=pde-3 PE=3 SV=4
8	P54750	7.93e-52	193	535	0.102	0.217	PDE1A_HUMAN Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Homo sapiens OX=9606 GN=PDE1A PE=1 SV=2
9	A0A0G2JZX9	2.70e-51	190	465	0.101	0.247	A0A0G2JZX9_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=2
10	A0A8I6GJQ6	2.85e-51	191	508	0.101	0.226	A0A8I6GJQ6_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
11	Q61481	3.17e-51	192	545	0.102	0.213	PDE1A_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A OS=Mus musculus OX=10090 GN=Pde1a PE=1 SV=3
12	Q9EPR9	3.48e-51	192	542	0.101	0.212	Q9EPR9_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=2 SV=1
13	A0A8I5Y879	4.35e-51	191	508	0.102	0.228	A0A8I5Y879_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
14	A0A0G2K2K1	4.48e-51	191	515	0.101	0.223	A0A0G2K2K1_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=2
15	A0A8I6A416	4.49e-51	191	542	0.101	0.212	A0A8I6A416_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
16	A0A8I6A5M3	8.35e-51	190	526	0.101	0.219	A0A8I6A5M3_RAT Phosphodiesterase OS=Rattus norvegicus OX=10116 GN=Pde1a PE=3 SV=1
17	Q64338	1.02e-50	194	706	0.103	0.166	PDE1C_MOUSE Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Mus musculus OX=10090 GN=Pde1c PE=1 SV=2
18	Q63421	2.32e-50	194	768	0.103	0.152	PDE1C_RAT Dual specificity calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C OS=Rattus norvegicus OX=10116 GN=Pde1c PE=1 SV=1
19	E7F6Z8	2.65e-50	191	611	0.098	0.183	E7F6Z8_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=3
20	A0A2R8RXK7	3.26e-50	190	587	0.098	0.191	A0A2R8RXK7_DANRE Phosphodiesterase OS=Danio rerio OX=7955 GN=pde1a PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00233 PDEase_I	3.6e-59	211.9	3'5'-cyclic nucleotide phosphodiesterase
2	PF11992 TgpA_N	5.9	17.5	TgpA N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351957

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000282096	0.908	cGMP-inhibited 3',5'-cyclic phosphodiesterase B
2	9606.ENSP00000286621	0.902	Adenosine kinase
3	9606.ENSP00000286648	0.900	Deoxycytidine kinase
4	9606.ENSP00000367615	0.900	Adenine phosphoribosyltransferase
5	9606.ENSP00000371230	0.900	GTP:AMP phosphotransferase AK3, mitochondrial
6	9606.ENSP00000485525	0.900	Adenylosuccinate lyase
7	9606.ENSP00000440045	0.866	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
8	9606.ENSP00000341083	0.809	Atrial natriuretic peptide receptor 2
9	9606.ENSP00000378063	0.789	Schlafen family member 12
10	9606.ENSP00000387123	0.787	Alpha-aminoadipic semialdehyde dehydrogenase
11	9606.ENSP00000311405	0.782	Adenylate cyclase type 6
12	9606.ENSP00000419361	0.765	Adenylate cyclase type 5
13	9606.ENSP00000378187	0.753	Adenylate cyclase type 7
14	9606.ENSP00000286355	0.746	Adenylate cyclase type 8
15	9606.ENSP00000309591	0.746	cAMP-dependent protein kinase catalytic subunit alpha
16	9606.ENSP00000312126	0.742	Adenylate cyclase type 4
17	9606.ENSP00000260600	0.741	Adenylate cyclase type 3
18	9606.ENSP00000282249	0.737	Guanylate cyclase soluble subunit alpha-2
19	9606.ENSP00000003084	0.736	Cystic fibrosis transmembrane conductance regulator
20	9606.ENSP00000296518	0.735	Guanylate cyclase 1, soluble, alpha 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004115	1.000	3',5'-cyclic-AMP phosphodiesterase activity
GO:0005515	0.999	protein binding
GO:0047555	0.991	3',5'-cyclic-GMP phosphodiesterase activity
GO:0042562	0.707	hormone binding
GO:0004119	0.570	cGMP-inhibited cyclic-nucleotide phosphodiesterase activity
GO:0099130	0.561	estrogen binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.986	response to stimulus
GO:0032501	0.960	multicellular organismal process
GO:0051716	0.908	cellular response to stimulus
GO:0023051	0.854	regulation of signaling
GO:0010646	0.850	regulation of cell communication
GO:0043949	0.827	regulation of cAMP-mediated signaling
GO:0048519	0.741	negative regulation of biological process
GO:0042221	0.720	response to chemical
GO:0007165	0.712	signal transduction
GO:0008152	0.692	metabolic process
GO:0032502	0.686	developmental process
GO:0048523	0.681	negative regulation of cellular process
GO:0071704	0.660	organic substance metabolic process
GO:0048856	0.650	anatomical structure development
GO:0065008	0.646	regulation of biological quality
GO:0044238	0.630	primary metabolic process
GO:0023057	0.462	negative regulation of signaling
GO:0010648	0.462	negative regulation of cell communication
GO:1902532	0.431	negative regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.961	membrane
GO:0043227	0.726	membrane-bounded organelle
GO:0043229	0.700	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:25277	1.000	3',5'-cyclic AMP + H2O = AMP + H(+)
EC:3.1.4.53	1.000	3',5'-cyclic-AMP phosphodiesterase.
RHEA:16957	0.991	3',5'-cyclic GMP + H2O = GMP + H(+)
EC:3.1.4.35	0.991	3',5'-cyclic-GMP phosphodiesterase.

[back to server]