StarFunc result for job id Q14444

User Input

>input (709 residues)
MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGV
IDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALS
QDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSE
EELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERV
FQSNYFDSTHNHQNGLCEEEEAASAPAVEDQVPEAEPEPAEEYTEQSEVESTEYVNRQFM
AETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQADPLVRRQRVQ
DLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQP
NQVPVQPEATQVPLVSSTSEGYTASQPLYQPSHATEQRPQKEPIDQIQATISLNTDQTTA
SSSLPAASQPQVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAPVPPVNEPETLKQQNQ
YQASYNQSFSSQPHQVEQTELQQEQLQTVVGTYHGSPDQSHQVTGNHQQPPQQNTGFPRS
NQPYYNSRGVSRGGSRGARGLMNGYRGPANGFRGGYDGYRPSFSNTPNSGYTQSQFSAPR
DYSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGMPQMNTQQVN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14444	1.000	1.000	6.986E-83	709	1.000	1.000	Q14444.pdb.gz	CAPR1_HUMAN Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2
2	AFDB:Q6IMN6	0.295	0.190	2.122E-21	1127	0.370	0.232	Q6IMN6.pdb.gz	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
3	AFDB:Q05A80	0.271	0.189	2.091E-20	1031	0.354	0.243	Q05A80.pdb.gz	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
4	AFDB:Q6S002	0.112	0.067	6.944E-3	1238	0.141	0.081	Q6S002.pdb.gz	KIF10_DICDI Kinesin-related protein 10 OS=Dictyostelium discoideum OX=44689 GN=kif10 PE=3 SV=1
5	AFDB:Q17602	0.082	0.046	1.109E-2	1390	0.171	0.087	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
6	AFDB:F4JWJ7	0.085	0.073	1.865E-2	845	0.151	0.127	F4JWJ7.pdb.gz	F4JWJ7_ARATH Transcription regulator NOT2/NOT3/NOT5 family protein OS=Arabidopsis thaliana OX=3702 GN=NOT3 PE=1 SV=1
7	AFDB:A0A0B4KFZ2	0.139	0.095	3.136E-2	1161	0.147	0.090	A0A0B4KFZ2.pdb.gz	A0A0B4KFZ2_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG31123 PE=1 SV=1
8	AFDB:F1Q4L8	0.071	0.057	4.513E-2	908	0.150	0.117	F1Q4L8.pdb.gz	F1Q4L8_DANRE CCR4-NOT transcription complex subunit 3 OS=Danio rerio OX=7955 GN=cnot3 PE=3 SV=2
9	AFDB:Q9JM52	0.101	0.058	5.853E-2	1308	0.164	0.089	Q9JM52.pdb.gz	MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus OX=10090 GN=Mink1 PE=1 SV=3
10	AFDB:A0A0R4IEP9	0.089	0.054	9.345E-2	1332	0.148	0.079	A0A0R4IEP9.pdb.gz	A0A0R4IEP9_DANRE TRAF2 and NCK interacting kinase a isoform X4 OS=Danio rerio OX=7955 GN=fc52d11 PE=1 SV=1
11	PDB:5bw9g	0.126	0.410	6.429E-1	141	0.032	0.163	5bw9g.pdb.gz
12	PDB:7aqrV	0.054	0.179	1.639	140	0.031	0.157	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
13	PDB:6r1mB	0.097	0.158	2.125	428	0.020	0.033	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
14	PDB:2zdiB	0.091	0.390	2.239	106	0.021	0.142	2zdiB.pdb.gz
15	PDB:5ng5A	0.087	0.163	2.756	340	0.018	0.038	5ng5A.pdb.gz	An allosteric transport mechanism for the AcrAB-TolC Multidrug Efflux Pump.
16	PDB:6tz402	0.123	0.401	3.058	176	0.028	0.114	6tz402.pdb.gz
17	PDB:3rx6A	0.081	0.236	3.394	187	0.042	0.160	3rx6A.pdb.gz
18	PDB:6wgeB	0.072	0.099	3.394	490	0.042	0.061	6wgeB.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
19	PDB:6q0xA	0.109	0.181	3.575	373	0.052	0.099	6q0xA.pdb.gz
20	PDB:7emf2	0.065	0.304	3.575	115	0.021	0.130	7emf2.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FDQ5	0.0	696	670	0.539	0.570	E7FDQ5_DANRE Cell cycle-associated protein 1a OS=Danio rerio OX=7955 GN=caprin PE=1 SV=1
2	G3V153	0.0	1293	628	0.886	1.000	G3V153_HUMAN Cell cycle associated protein 1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=1
3	Q14444	0.0	1456	709	1.000	1.000	CAPR1_HUMAN Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2
4	Q5M9G3	0.0	1399	707	0.965	0.967	CAPR1_RAT Caprin-1 OS=Rattus norvegicus OX=10116 GN=Caprin1 PE=1 SV=2
5	Q60865	0.0	1408	707	0.969	0.972	CAPR1_MOUSE Caprin-1 OS=Mus musculus OX=10090 GN=Caprin1 PE=1 SV=2
6	Q6DBQ6	0.0	681	657	0.526	0.568	Q6DBQ6_DANRE GPI-anchored membrane protein 1 OS=Danio rerio OX=7955 GN=zgc:92043 PE=1 SV=1
7	E9PLA9	6.21e-127	376	186	0.262	1.000	E9PLA9_HUMAN Cell cycle associated protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=1
8	Q05A80	6.74e-63	229	1031	0.164	0.113	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
9	F5H142	5.89e-60	216	702	0.161	0.162	F5H142_HUMAN Caprin family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
10	Q6IMN6	4.17e-59	218	1127	0.162	0.102	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
11	Q5RJ80	7.40e-54	202	914	0.268	0.208	CAPR2_DANRE Caprin-2 OS=Danio rerio OX=7955 GN=caprin2 PE=1 SV=1
12	H3BM22	3.88e-35	144	706	0.181	0.181	H3BM22_HUMAN Caprin family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
13	Q9I7D3	7.86e-23	106	961	0.092	0.068	CAPR1_DROME Caprin homolog OS=Drosophila melanogaster OX=7227 GN=Capr PE=1 SV=1
14	Q9LFX8	0.001	44.7	420	0.075	0.126	Q9LFX8_ARATH Glycine-rich protein OS=Arabidopsis thaliana OX=3702 GN=At1g27090 PE=1 SV=1
15	Q9VVA7	1.1	34.7	408	0.068	0.118	Q9VVA7_DROME Tumor suppressor protein 101 OS=Drosophila melanogaster OX=7227 GN=TSG101 PE=1 SV=2
16	A0MZ67	3.1	33.5	633	0.028	0.032	SHOT1_RAT Shootin-1 OS=Rattus norvegicus OX=10116 GN=Shtn1 PE=1 SV=1
17	H6D7E6	3.4	33.5	1554	0.062	0.028	TALD3_DANRE Protein TALPID3 OS=Danio rerio OX=7955 GN=talpid3 PE=2 SV=1
18	Q1W617	4.6	33.1	1475	0.045	0.022	SHRM4_MOUSE Protein Shroom4 OS=Mus musculus OX=10090 GN=Shroom4 PE=1 SV=1
19	Q8K2Q9	5.6	32.7	631	0.028	0.032	SHOT1_MOUSE Shootin-1 OS=Mus musculus OX=10090 GN=Shtn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12287 Caprin-1_C	2.4e-129	443.8	Cytoplasmic activation/proliferation-associated protein-1 C term
2	PF18293 Caprin-1_dimer	7.5e-38	140.9	Caprin-1 dimerization domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010356662.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010356954.1	0.963	G3BP stress granule assembly factor 1
2	61622.XP_010354225.1	0.919	RAB28, member RAS oncogene family
3	61622.XP_010376612.1	0.919	Ras-related protein Rab-28-like
4	61622.XP_010375411.1	0.917	G3BP stress granule assembly factor 2
5	61622.XP_010374257.1	0.894	Fragile X mental retardation 1
6	61622.XP_010358307.1	0.832	Speckle type BTB/POZ protein
7	61622.XP_010350826.1	0.807	FMR1 autosomal homolog 1
8	61622.XP_010360194.1	0.778	TIA1 cytotoxic granule associated RNA binding protein
9	61622.XP_010360670.1	0.738	FMR1 autosomal homolog 2
10	61622.XP_010356663.1	0.716	RNA cytidine acetyltransferase with specificity toward both 18S rRNA and tRNAs. Catalyzes the formation of N(4)-acetylcytidine (ac4C) in 18S rRNA. Required for early nucleolar cleavages of precursor rRNA at sites A0, A1 and A2 during 18S rRNA synthesis. Catalyzes the formation of ac4C in serine and leucine tRNAs. Requires the tRNA- binding adapter protein THUMPD1 for full tRNA acetyltransferase activity but not for 18S rRNA acetylation
11	61622.XP_010366358.1	0.697	Nuclear fragile X mental retardation-interacting protein 1
12	61622.XP_010374280.1	0.647	TIA1 cytotoxic granule associated RNA binding protein like 1
13	61622.XP_010384522.1	0.643	Caprin-2-like
14	61622.XP_010379896.1	0.642	Speckle-type POZ protein-like
15	61622.XP_010384551.1	0.642	Belongs to the adenosylhomocysteinase family.
16	61622.XP_010382700.1	0.631	Huntingtin
17	61622.XP_010375659.1	0.617	Exportin-1 isoform X1
18	61622.XP_010365473.1	0.601	KH-type splicing regulatory protein
19	61622.XP_010365029.1	0.599	Eukaryotic translation initiation factor 2 subunit 1
20	61622.XP_010363738.1	0.585	2-oxoglutarate and iron dependent oxygenase domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0048518	0.941	positive regulation of biological process
GO:0048522	0.934	positive regulation of cellular process
GO:0019222	0.917	regulation of metabolic process
GO:0060255	0.903	regulation of macromolecule metabolic process
GO:0031323	0.842	regulation of cellular metabolic process
GO:0080090	0.840	regulation of primary metabolic process
GO:0051171	0.831	regulation of nitrogen compound metabolic process
GO:0010468	0.830	regulation of gene expression
GO:0048519	0.690	negative regulation of biological process
GO:0010556	0.680	regulation of macromolecule biosynthetic process
GO:0031326	0.680	regulation of cellular biosynthetic process
GO:0048523	0.679	negative regulation of cellular process
GO:0051246	0.663	regulation of protein metabolic process
GO:0010605	0.642	negative regulation of macromolecule metabolic process
GO:0031324	0.625	negative regulation of cellular metabolic process
GO:0010608	0.607	post-transcriptional regulation of gene expression
GO:0006417	0.584	regulation of translation
GO:0051172	0.582	negative regulation of nitrogen compound metabolic process
GO:0009987	0.476	cellular process
GO:0065008	0.442	regulation of biological quality
GO:0010558	0.440	negative regulation of macromolecule biosynthetic process
GO:0031327	0.440	negative regulation of cellular biosynthetic process
GO:0010629	0.363	negative regulation of gene expression
GO:0051130	0.344	positive regulation of cellular component organization
GO:0017148	0.336	negative regulation of translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.996	intracellular organelle
GO:0016020	0.994	membrane
GO:0005829	0.994	cytosol
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0099080	0.976	supramolecular complex
GO:0032991	0.944	protein-containing complex
GO:0036464	0.885	cytoplasmic ribonucleoprotein granule
GO:0043231	0.846	intracellular membrane-bounded organelle
GO:0070013	0.792	intracellular organelle lumen
GO:0031981	0.782	nuclear lumen
GO:0030054	0.559	cell junction
GO:0005654	0.546	nucleoplasm
GO:0010494	0.442	cytoplasmic stress granule
GO:0012505	0.339	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]