StarFunc result for job id Q14451

User Input

>input (532 residues)
MELDLSPPHLSSSPEDLCPAPGTPPGTPRPPDTPLPEEVKRSQPLLIPTTGRKLREEERR
ATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAA
GATARHVCEMLVQRAHALSDETWGLVECHPHLALERGLEDHESVVEVQAAWPVGGDSRFV
FRKNFAKYELFKSSPHSLFPEKMVSSCLDAHTGISHEDLIQNFLNAGSFPEIQGFLQLRG
SGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRKLYGMPTDFG
FCVKPNKLRNGHKGLRIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRHLHPSCLG
SPPLRSASDNTLVAMDFSGHAGRVIENPREALSVALEEAQAWRKKTNHRLSLPMPASGTS
LSAAIHRTQLWFHGRISREESQRLIGQQGLVDGLFLVRESQRNPQGFVLSLCHLQKVKHY
LILPSEEEGRLYFSMDDGQTRFTDLLQLVEFHQLNRGILPCLLRHCCTRVAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q03160	0.724	0.720	1.789E-88	535	0.906	0.901	Q03160.pdb.gz	GRB7_MOUSE Growth factor receptor-bound protein 7 OS=Mus musculus OX=10090 GN=Grb7 PE=1 SV=1
2	AFDB:P0CE43	0.733	0.654	4.461E-59	599	0.519	0.461	P0CE43.pdb.gz	GRB10_RAT Growth factor receptor-bound protein 10 OS=Rattus norvegicus OX=10116 GN=Grb10 PE=3 SV=1
3	AFDB:Q14449	0.711	0.701	5.875E-59	540	0.489	0.481	Q14449.pdb.gz	GRB14_HUMAN Growth factor receptor-bound protein 14 OS=Homo sapiens OX=9606 GN=GRB14 PE=1 SV=2
4	AFDB:Q60760	0.728	0.627	1.202E-58	621	0.502	0.430	Q60760.pdb.gz	GRB10_MOUSE Growth factor receptor-bound protein 10 OS=Mus musculus OX=10090 GN=Grb10 PE=1 SV=2
5	AFDB:O88900	0.745	0.737	6.065E-56	538	0.457	0.452	O88900.pdb.gz	GRB14_RAT Growth factor receptor-bound protein 14 OS=Rattus norvegicus OX=10116 GN=Grb14 PE=1 SV=1
6	AFDB:G5E867	0.428	0.339	2.056E-23	679	0.201	0.158	G5E867.pdb.gz	G5E867_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=1
7	AFDB:F2Z3U3	0.420	0.182	6.906E-23	1266	0.218	0.092	F2Z3U3.pdb.gz	F2Z3U3_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2
8	AFDB:Q7Z5R6	0.425	0.343	2.196E-22	666	0.186	0.149	Q7Z5R6.pdb.gz	AB1IP_HUMAN Amyloid beta A4 precursor protein-binding family B member 1-interacting protein OS=Homo sapiens OX=9606 GN=APBB1IP PE=1 SV=1
9	AFDB:Q9VWB7	0.428	0.201	3.411E-22	1162	0.192	0.088	Q9VWB7.pdb.gz	Q9VWB7_DROME LD06925p OS=Drosophila melanogaster OX=7227 GN=pico PE=2 SV=1
10	AFDB:P34400	0.428	0.296	6.980E-22	779	0.203	0.139	P34400.pdb.gz	MIG10_CAEEL Abnormal cell migration protein 10 OS=Caenorhabditis elegans OX=6239 GN=mig-10 PE=1 SV=3
11	PDB:4k2rA	0.185	0.178	1.249E-7	551	0.062	0.060	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
12	PDB:4fl2A	0.182	0.175	4.435E-7	555	0.071	0.068	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:1k9aB	0.149	0.179	9.074E-7	441	0.068	0.082	1k9aB.pdb.gz
14	PDB:5xzrA	0.161	0.165	1.425E-5	519	0.056	0.058	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
15	PDB:4rm8A	0.150	0.205	1.681E-5	368	0.075	0.109	4rm8A.pdb.gz
16	PDB:1ka6A	0.168	0.735	1.983E-5	107	0.047	0.234	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
17	PDB:4gwfA	0.157	0.167	2.759E-5	497	0.060	0.064	4gwfA.pdb.gz
18	PDB:2h8hA	0.172	0.204	5.966E-5	445	0.058	0.070	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
19	PDB:3ps5A	0.152	0.153	6.304E-5	529	0.053	0.053	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
20	PDB:7c3mA	0.148	0.138	6.660E-5	577	0.139	0.128	7c3mA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q03160	0.0	948	535	0.908	0.903	GRB7_MOUSE Growth factor receptor-bound protein 7 OS=Mus musculus OX=10090 GN=Grb7 PE=1 SV=1
2	Q13322	0.0	559	594	0.536	0.480	GRB10_HUMAN Growth factor receptor-bound protein 10 OS=Homo sapiens OX=9606 GN=GRB10 PE=1 SV=2
3	Q14451	0.0	1095	532	1.000	1.000	GRB7_HUMAN Growth factor receptor-bound protein 7 OS=Homo sapiens OX=9606 GN=GRB7 PE=1 SV=2
4	Q9QZC5	0.0	927	535	0.910	0.905	GRB7_RAT Growth factor receptor-bound protein 7 OS=Rattus norvegicus OX=10116 GN=Grb7 PE=1 SV=1
5	Q14449	2.84e-175	507	540	0.464	0.457	GRB14_HUMAN Growth factor receptor-bound protein 14 OS=Homo sapiens OX=9606 GN=GRB14 PE=1 SV=2
6	Q60760	3.43e-175	509	621	0.457	0.391	GRB10_MOUSE Growth factor receptor-bound protein 10 OS=Mus musculus OX=10090 GN=Grb10 PE=1 SV=2
7	P0CE43	1.28e-174	507	599	0.455	0.404	GRB10_RAT Growth factor receptor-bound protein 10 OS=Rattus norvegicus OX=10116 GN=Grb10 PE=3 SV=1
8	Q5ICW4	2.23e-173	502	540	0.464	0.457	GRB14_BOVIN Growth factor receptor-bound protein 14 OS=Bos taurus OX=9913 GN=GRB14 PE=1 SV=1
9	O88900	7.42e-168	488	538	0.455	0.450	GRB14_RAT Growth factor receptor-bound protein 14 OS=Rattus norvegicus OX=10116 GN=Grb14 PE=1 SV=1
10	Q9JLM9	9.19e-165	480	538	0.455	0.450	GRB14_MOUSE Growth factor receptor-bound protein 14 OS=Mus musculus OX=10090 GN=Grb14 PE=1 SV=1
11	C9K0J5	2.75e-36	146	1302	0.147	0.060	C9K0J5_HUMAN Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=1
12	Q70E73	3.42e-36	146	1250	0.147	0.062	RAPH1_HUMAN Ras-associated and pleckstrin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=RAPH1 PE=1 SV=3
13	G5E867	8.36e-36	144	679	0.147	0.115	G5E867_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=1
14	F2Z3U3	1.00e-35	144	1266	0.147	0.062	F2Z3U3_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=2
15	F2Z4B7	1.22e-35	143	645	0.147	0.121	F2Z4B7_MOUSE Ras association (RalGDS/AF-6) and pleckstrin homology domains 1 OS=Mus musculus OX=10090 GN=Raph1 PE=1 SV=1
16	Q7Z5R6	6.12e-35	141	666	0.147	0.117	AB1IP_HUMAN Amyloid beta A4 precursor protein-binding family B member 1-interacting protein OS=Homo sapiens OX=9606 GN=APBB1IP PE=1 SV=1
17	Q8R5A3	1.86e-33	137	670	0.143	0.113	AB1IP_MOUSE Amyloid beta A4 precursor protein-binding family B member 1-interacting protein OS=Mus musculus OX=10090 GN=Apbb1ip PE=1 SV=2
18	Q8IQW0	2.55e-28	122	1034	0.143	0.074	Q8IQW0_DROME Pico, isoform B OS=Drosophila melanogaster OX=7227 GN=pico PE=4 SV=1
19	M9MSQ5	2.86e-28	122	1113	0.143	0.068	M9MSQ5_DROME Pico, isoform C OS=Drosophila melanogaster OX=7227 GN=pico PE=4 SV=1
20	Q9VWB7	3.73e-28	121	1162	0.143	0.065	Q9VWB7_DROME LD06925p OS=Drosophila melanogaster OX=7227 GN=pico PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08947 BPS	2.3e-25	99.6	BPS (Between PH and SH2)
2	PF00169 PH	1.2e-05	37.1	PH domain
3	PF00788 RA	1.7e-11	55.9	Ras association (RalGDS/AF-6) domain
4	PF00017 SH2	8.3e-13	59.6	SH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403459

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269571	0.999	Receptor tyrosine-protein kinase erbB-2
2	9606.ENSP00000381097	0.997	Ephrin type-B receptor 1
3	9606.ENSP00000267101	0.987	Receptor tyrosine-protein kinase erbB-3
4	9606.ENSP00000341189	0.985	Focal adhesion kinase 1
5	9606.ENSP00000275493	0.981	Epidermal growth factor receptor
6	9606.ENSP00000347942	0.978	Proto-oncogene tyrosine-protein kinase receptor Ret
7	9606.ENSP00000339191	0.973	Caveolin-1
8	9606.ENSP00000369375	0.971	Angiopoietin-1 receptor
9	9606.ENSP00000362680	0.958	Proto-oncogene tyrosine-protein kinase Src
10	9606.ENSP00000386665	0.951	Four and a half LIM domains protein 2
11	9606.ENSP00000346671	0.924	Tyrosine-protein kinase Fyn
12	9606.ENSP00000204961	0.914	Ephrin-B1
13	9606.ENSP00000337825	0.913	Tyrosine-protein kinase Lck
14	9606.ENSP00000462468	0.912	Tyrosine-protein kinase Yes
15	9606.ENSP00000428340	0.908	Angiopoietin-1
16	9606.ENSP00000245323	0.906	Ephrin-B2
17	9606.ENSP00000381793	0.904	Growth factor receptor-bound protein 10
18	9606.ENSP00000409007	0.901	Glial cell line-derived neurotrophic factor
19	9606.ENSP00000226091	0.900	Ephrin-B3
20	9606.ENSP00000347591	0.900	GDNF family receptor alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.657	enzyme binding
GO:0060090	0.537	molecular adaptor activity
GO:0044877	0.444	protein-containing complex binding
GO:0005102	0.388	signaling receptor binding
GO:0051219	0.331	phosphoprotein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051716	0.997	cellular response to stimulus
GO:0023052	0.996	signaling
GO:0007154	0.996	cell communication
GO:0007165	0.994	signal transduction
GO:0048518	0.968	positive regulation of biological process
GO:0007169	0.943	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048522	0.935	positive regulation of cellular process
GO:0048519	0.800	negative regulation of biological process
GO:0048523	0.750	negative regulation of cellular process
GO:0040012	0.706	regulation of locomotion
GO:0038127	0.655	ERBB signaling pathway
GO:0019222	0.565	regulation of metabolic process
GO:0031323	0.496	regulation of cellular metabolic process
GO:0060255	0.489	regulation of macromolecule metabolic process
GO:2000145	0.419	regulation of cell motility
GO:0048583	0.369	regulation of response to stimulus
GO:0030334	0.365	regulation of cell migration
GO:0080090	0.344	regulation of primary metabolic process
GO:0032501	0.333	multicellular organismal process
GO:0031326	0.319	regulation of cellular biosynthetic process
GO:0051171	0.318	regulation of nitrogen compound metabolic process
GO:0007173	0.317	epidermal growth factor receptor signaling pathway
GO:0032502	0.316	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.961	intracellular organelle
GO:0071944	0.946	cell periphery
GO:0005886	0.943	plasma membrane
GO:0030054	0.865	cell junction
GO:0043227	0.772	membrane-bounded organelle
GO:0043231	0.739	intracellular membrane-bounded organelle
GO:0043228	0.357	non-membrane-bounded organelle
GO:0043232	0.352	intracellular non-membrane-bounded organelle
GO:0070161	0.324	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]