StarFunc result for job id Q14457

User Input

>input (450 residues)
MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE
ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG
DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL
QMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ
LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF
WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1X5	0.625	0.625	9.104E-65	450	1.000	1.000	A0A024R1X5.pdb.gz	A0A024R1X5_HUMAN Beclin-1 OS=Homo sapiens OX=9606 GN=BECN1 PE=2 SV=1
2	AFDB:F6PQC7	0.633	0.604	6.560E-64	473	0.998	0.949	F6PQC7.pdb.gz	F6PQC7_MACMU Beclin-1 OS=Macaca mulatta OX=9544 GN=BECN1 PE=3 SV=3
3	AFDB:F1RCP1	0.595	0.599	4.511E-57	447	0.787	0.792	F1RCP1.pdb.gz	BECN1_DANRE Beclin-1 OS=Danio rerio OX=7955 GN=becn1 PE=2 SV=3
4	AFDB:A8MW95	0.574	0.597	1.171E-40	431	0.542	0.566	A8MW95.pdb.gz	BECN2_HUMAN Beclin-2 OS=Homo sapiens OX=9606 GN=BECN2 PE=1 SV=2
5	AFDB:Q9VCE1	0.555	0.589	8.441E-40	422	0.482	0.514	Q9VCE1.pdb.gz	BECN1_DROME Beclin-1-like protein OS=Drosophila melanogaster OX=7227 GN=Atg6 PE=1 SV=1
6	PDB:7bl1EEE	0.432	0.542	6.031E-38	337	0.747	0.997	7bl1EEE.pdb.gz	Structural basis for VPS34 kinase activation by Rab1 and Rab5 on membranes.
7	AFDB:P0DM65	0.531	0.534	3.743E-33	447	0.449	0.452	P0DM65.pdb.gz	BECN2_MOUSE Beclin-2 OS=Mus musculus OX=10090 GN=Becn2 PE=1 SV=2
8	AFDB:Q9M367	0.542	0.484	4.002E-24	517	0.313	0.273	Q9M367.pdb.gz	BECN1_ARATH Beclin-1-like protein OS=Arabidopsis thaliana OX=3702 GN=ATG6 PE=1 SV=2
9	AFDB:Q22592	0.516	0.608	2.195E-22	375	0.260	0.312	Q22592.pdb.gz	BECN_CAEEL Beclin homolog OS=Caenorhabditis elegans OX=6239 GN=bec-1 PE=1 SV=2
10	AFDB:Q02948	0.389	0.330	1.342E-21	557	0.296	0.239	Q02948.pdb.gz	BECN1_YEAST Vacuolar protein sorting-associated protein 30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS30 PE=1 SV=1
11	AFDB:Q55CC5	0.492	0.175	1.507E-16	1368	0.231	0.076	Q55CC5.pdb.gz	BECNA_DICDI Beclin-1-like protein A OS=Dictyostelium discoideum OX=44689 GN=atg6A PE=3 SV=1
12	PDB:5dfzD	0.384	0.478	3.605E-13	341	0.233	0.308	5dfzD.pdb.gz
13	PDB:6jp5E	0.105	0.247	4.320E-1	169	0.036	0.095	6jp5E.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
14	PDB:7emfN	0.086	0.046	1.526	1017	0.031	0.014	7emfN.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
15	PDB:7nvrl	0.083	0.077	1.612	501	0.033	0.030	7nvrl.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
16	PDB:4y0hD	0.066	0.065	2.007	463	0.024	0.024	4y0hD.pdb.gz	Mechanism of inactivation of gamma-aminobutyric acid aminotransferase by (1S,3S)-3-amino-4-difluoromethylenyl-1-cyclopentanoic acid (CPP-115)
17	PDB:7r5vO	0.081	0.152	2.240	210	0.029	0.062	7r5vO.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
18	PDB:6qb8d	0.081	0.075	2.366	489	0.042	0.039	6qb8d.pdb.gz	Structural and functional analysis of the role of the chaperonin CCT in mTOR complex assembly.
19	PDB:6eeiB	0.071	0.068	2.640	471	0.027	0.025	6eeiB.pdb.gz	Structural basis for divergent and convergent evolution of catalytic machineries in plant aromatic amino acid decarboxylase proteins.
20	PDB:5dfzA	0.167	0.209	3.113	343	0.069	0.090	5dfzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R1X5	0.0	936	450	1.000	1.000	A0A024R1X5_HUMAN Beclin-1 OS=Homo sapiens OX=9606 GN=BECN1 PE=2 SV=1
2	F1RCP1	0.0	736	447	0.787	0.792	BECN1_DANRE Beclin-1 OS=Danio rerio OX=7955 GN=becn1 PE=2 SV=3
3	F6PQC7	0.0	920	473	0.998	0.949	F6PQC7_MACMU Beclin-1 OS=Macaca mulatta OX=9544 GN=BECN1 PE=3 SV=3
4	O88597	0.0	909	448	0.980	0.984	BECN1_MOUSE Beclin-1 OS=Mus musculus OX=10090 GN=Becn1 PE=1 SV=3
5	Q14457	0.0	936	450	1.000	1.000	BECN1_HUMAN Beclin-1 OS=Homo sapiens OX=9606 GN=BECN1 PE=1 SV=2
6	Q4A1L4	0.0	907	448	0.980	0.984	BECN1_BOVIN Beclin-1 OS=Bos taurus OX=9913 GN=BECN1 PE=1 SV=1
7	Q91XJ1	0.0	904	448	0.973	0.978	BECN1_RAT Beclin-1 OS=Rattus norvegicus OX=10116 GN=Becn1 PE=1 SV=1
8	A8MW95	1.11e-154	447	431	0.542	0.566	BECN2_HUMAN Beclin-2 OS=Homo sapiens OX=9606 GN=BECN2 PE=1 SV=2
9	Q9VCE1	2.18e-144	421	422	0.484	0.517	BECN1_DROME Beclin-1-like protein OS=Drosophila melanogaster OX=7227 GN=Atg6 PE=1 SV=1
10	P0DM65	1.38e-112	340	447	0.451	0.454	BECN2_MOUSE Beclin-2 OS=Mus musculus OX=10090 GN=Becn2 PE=1 SV=2
11	Q9M367	3.72e-58	201	517	0.300	0.261	BECN1_ARATH Beclin-1-like protein OS=Arabidopsis thaliana OX=3702 GN=ATG6 PE=1 SV=2
12	P87117	9.39e-56	193	464	0.304	0.295	BECN1_SCHPO Vacuolar protein sorting-associated protein atg6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atg6 PE=3 SV=4
13	Q02948	8.35e-38	146	557	0.253	0.205	BECN1_YEAST Vacuolar protein sorting-associated protein 30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS30 PE=1 SV=1
14	Q22592	7.07e-33	130	375	0.216	0.259	BECN_CAEEL Beclin homolog OS=Caenorhabditis elegans OX=6239 GN=bec-1 PE=1 SV=2
15	Q55CC5	1.06e-28	122	1368	0.191	0.063	BECNA_DICDI Beclin-1-like protein A OS=Dictyostelium discoideum OX=44689 GN=atg6A PE=3 SV=1
16	Q9NYC9	0.026	39.7	4486	0.060	0.006	DYH9_HUMAN Dynein axonemal heavy chain 9 OS=Homo sapiens OX=9606 GN=DNAH9 PE=1 SV=3
17	A5ABP0	0.11	37.4	694	0.104	0.068	A5ABP0_ASPNC Contig An11c0340, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An11g09910 PE=4 SV=1
18	Q8BPN8	0.15	37.4	3032	0.100	0.015	DMXL2_MOUSE DmX-like protein 2 OS=Mus musculus OX=10090 GN=Dmxl2 PE=1 SV=3
19	Q9QXL1	0.39	35.8	1668	0.073	0.020	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
20	O75037	0.43	35.8	1637	0.073	0.020	KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04111 APG6	1.3e-72	255.0	Apg6 BARA domain
2	PF17675 APG6_N	3.9e-28	110.0	Apg6 coiled-coil region
3	PF15285 BH3	1.1e-13	61.8	Beclin-1 BH3 domain, Bcl-2-interacting
4	PF02601 Exonuc_VII_L	6.2e+02	11.3	Exonuclease VII, large subunit
5	PF05911 FPP	7e+02	9.8	Filament-like plant protein, long coiled-coil
6	PF14932 HAUS-augmin3	32	15.5	HAUS augmin-like complex subunit 3
7	PF12777 MT	22	15.5	Microtubule-binding stalk of dynein motor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355231

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000247178	0.999	Beclin 1-associated autophagy-related key regulator
2	9606.ENSP00000262039	0.999	Phosphatidylinositol 3-kinase catalytic subunit type 3
3	9606.ENSP00000302564	0.999	Bcl-2-like protein 1
4	9606.ENSP00000324560	0.999	Serine/threonine-protein kinase ULK1
5	9606.ENSP00000348455	0.999	UV radiation resistance-associated gene protein
6	9606.ENSP00000349205	0.999	Phosphoinositide 3-kinase regulatory subunit 4
7	9606.ENSP00000381185	0.999	Apoptosis regulator Bcl-2
8	9606.ENSP00000431926	0.999	Activating molecule in BECN1-regulated autophagy protein 1
9	9606.ENSP00000262291	0.998	Vacuole membrane protein 1
10	9606.ENSP00000296343	0.998	Run domain Beclin-1-interacting and cysteine-rich domain-containing protein
11	9606.ENSP00000345347	0.998	High mobility group protein B1
12	9606.ENSP00000364204	0.998	Serine/threonine-protein kinase PINK1, mitochondrial
13	9606.ENSP00000432412	0.997	Autophagy-related protein 13
14	9606.ENSP00000355865	0.996	E3 ubiquitin-protein ligase parkin
15	9606.ENSP00000358022	0.995	Induced myeloid leukemia cell differentiation protein Mcl-1
16	9606.ENSP00000025008	0.994	RB1-inducible coiled-coil protein 1
17	9606.ENSP00000268607	0.994	Microtubule-associated proteins 1A/1B light chain 3B
18	9606.ENSP00000306866	0.994	Gamma-aminobutyric acid receptor-associated protein
19	9606.ENSP00000363970	0.994	Microtubule-associated proteins 1A/1B light chain 3A
20	9606.ENSP00000401399	0.994	Myeloid differentiation primary response protein MyD88

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.811	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0008152	0.993	metabolic process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0019222	0.985	regulation of metabolic process
GO:0031323	0.984	regulation of cellular metabolic process
GO:0010506	0.972	regulation of autophagy
GO:0048519	0.971	negative regulation of biological process
GO:0071840	0.965	cellular component organization or biogenesis
GO:0048523	0.963	negative regulation of cellular process
GO:0016043	0.962	cellular component organization
GO:0016241	0.962	regulation of macroautophagy
GO:0051716	0.961	cellular response to stimulus
GO:0044237	0.956	cellular metabolic process
GO:0006996	0.949	organelle organization
GO:0006950	0.946	response to stress
GO:0051128	0.946	regulation of cellular component organization
GO:0033554	0.943	cellular response to stress
GO:0048583	0.941	regulation of response to stimulus
GO:0048518	0.936	positive regulation of biological process
GO:0010941	0.936	regulation of cell death
GO:0042981	0.934	regulation of apoptotic process
GO:0016236	0.920	macroautophagy
GO:0031331	0.919	positive regulation of cellular catabolic process
GO:0033043	0.896	regulation of organelle organization
GO:0010508	0.890	positive regulation of autophagy
GO:0007033	0.848	vacuole organization
GO:1905037	0.842	autophagosome organization
GO:0044087	0.821	regulation of cellular component biogenesis
GO:0044088	0.817	regulation of vacuole organization
GO:2000785	0.814	regulation of autophagosome assembly
GO:0009605	0.812	response to external stimulus
GO:0071704	0.783	organic substance metabolic process
GO:0071496	0.779	cellular response to external stimulus
GO:0007154	0.752	cell communication
GO:0031667	0.666	response to nutrient levels
GO:0022607	0.638	cellular component assembly
GO:0070925	0.620	organelle assembly
GO:0044238	0.617	primary metabolic process
GO:0023051	0.594	regulation of signaling
GO:0051179	0.585	localization
GO:0032502	0.568	developmental process
GO:0042221	0.541	response to chemical
GO:0009966	0.529	regulation of signal transduction
GO:0043069	0.526	negative regulation of programmed cell death
GO:0048584	0.516	positive regulation of response to stimulus
GO:0043066	0.515	negative regulation of apoptotic process
GO:0006807	0.510	nitrogen compound metabolic process
GO:0051234	0.485	establishment of localization
GO:0006810	0.469	transport
GO:0043170	0.464	macromolecule metabolic process
GO:0022411	0.463	cellular component disassembly
GO:1901564	0.421	organonitrogen compound metabolic process
GO:0032501	0.402	multicellular organismal process
GO:0051171	0.401	regulation of nitrogen compound metabolic process
GO:0060255	0.397	regulation of macromolecule metabolic process
GO:0009267	0.384	cellular response to starvation
GO:0000045	0.380	autophagosome assembly
GO:0080090	0.357	regulation of primary metabolic process
GO:0016192	0.346	vesicle-mediated transport
GO:1902531	0.330	regulation of intracellular signal transduction
GO:0019538	0.317	protein metabolic process
GO:0070887	0.315	cellular response to chemical stimulus
GO:0009892	0.312	negative regulation of metabolic process
GO:1902533	0.312	positive regulation of intracellular signal transduction
GO:2001233	0.310	regulation of apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0012505	0.997	endomembrane system
GO:0005654	0.995	nucleoplasm
GO:0032991	0.993	protein-containing complex
GO:1902494	0.977	catalytic complex
GO:0031982	0.974	vesicle
GO:0031410	0.962	cytoplasmic vesicle
GO:1990234	0.946	transferase complex
GO:0016604	0.933	nuclear body
GO:0098796	0.929	membrane protein complex
GO:0061695	0.918	transferase complex, transferring phosphorus-containing groups
GO:0005942	0.910	phosphatidylinositol 3-kinase complex
GO:0005739	0.838	mitochondrion
GO:0035032	0.799	phosphatidylinositol 3-kinase complex, class III
GO:0031090	0.678	organelle membrane
GO:0043232	0.631	intracellular non-membrane-bounded organelle
GO:0005794	0.535	Golgi apparatus
GO:0071944	0.491	cell periphery
GO:0031984	0.488	organelle subcompartment
GO:0005886	0.436	plasma membrane
GO:0005768	0.390	endosome
GO:0098791	0.355	Golgi apparatus subcompartment
GO:0120025	0.335	plasma membrane bounded cell projection
GO:0005802	0.320	trans-Golgi network
GO:0098588	0.303	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]