StarFunc result for job id Q14469

User Input

>input (280 residues)
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35428	0.848	0.843	3.641E-40	282	0.982	0.975	P35428.pdb.gz	HES1_MOUSE Transcription factor HES-1 OS=Mus musculus OX=10090 GN=Hes1 PE=1 SV=1
2	AFDB:Q6IRB2	0.598	0.622	4.773E-30	267	0.754	0.790	Q6IRB2.pdb.gz	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
3	AFDB:Q90468	0.344	0.295	1.032E-27	334	0.761	0.638	Q90468.pdb.gz
4	AFDB:Q90Z12	0.478	0.477	7.217E-25	281	0.639	0.637	Q90Z12.pdb.gz	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
5	AFDB:O57337	0.463	0.449	1.714E-24	290	0.657	0.634	O57337.pdb.gz	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
6	AFDB:A7MCR9	0.333	0.321	5.457E-23	291	0.629	0.605	A7MCR9.pdb.gz
7	AFDB:Q9HCC6	0.428	0.521	8.636E-17	221	0.457	0.579	Q9HCC6.pdb.gz	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
8	AFDB:Q26263	0.294	0.196	6.530E-15	435	0.357	0.230	Q26263.pdb.gz	DPN_DROME Protein deadpan OS=Drosophila melanogaster OX=7227 GN=dpn PE=1 SV=2
9	AFDB:F1QI81	0.253	0.316	1.117E-9	221	0.311	0.394	F1QI81.pdb.gz	F1QI81_DANRE Hairy-related 8a OS=Danio rerio OX=7955 GN=her-8a PE=4 SV=2
10	AFDB:G3V7S6	0.234	0.200	6.304E-9	339	0.307	0.254	G3V7S6.pdb.gz	G3V7S6_RAT Hes-related family bHLH transcription factor with YRPW motif 2 OS=Rattus norvegicus OX=10116 GN=Hey2 PE=4 SV=1
11	PDB:7nb6A	0.163	0.141	1.716	340	0.061	0.050	7nb6A.pdb.gz
12	PDB:2p22C	0.156	0.219	3.832	186	0.082	0.124	2p22C.pdb.gz
13	PDB:3a7lA	0.056	0.122	3.832	128	0.011	0.023	3a7lA.pdb.gz
14	PDB:7ungi	0.118	0.128	3.832	250	0.039	0.044	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:7msmx	0.151	0.084	4.076	553	0.025	0.013	7msmx.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
16	PDB:7wtww	0.091	0.080	4.076	332	0.086	0.072	7wtww.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
17	PDB:1fx7A	0.069	0.082	4.336	230	0.025	0.030	1fx7A.pdb.gz	Crystal structure of the iron-dependent regulator from Mycobacterium tuberculosis at 2.0-A resolution reveals the Src homology domain 3-like fold and metal binding function of the third domain.
18	PDB:1ka6A	0.069	0.167	4.906	107	0.014	0.037	1ka6A.pdb.gz	A "three-pronged" binding mechanism for the SAP/SH2D1A SH2 domain: structural basis and relevance to the XLP syndrome.
19	PDB:2z4hB	0.090	0.123	4.906	194	0.018	0.026	2z4hB.pdb.gz
20	PDB:5xjxC	0.062	0.048	4.906	365	0.011	0.008	5xjxC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35428	0.0	550	282	0.982	0.975	HES1_MOUSE Transcription factor HES-1 OS=Mus musculus OX=10090 GN=Hes1 PE=1 SV=1
2	Q04666	0.0	558	281	0.989	0.986	HES1_RAT Transcription factor HES-1 OS=Rattus norvegicus OX=10116 GN=Hes1 PE=1 SV=1
3	Q14469	0.0	570	280	1.000	1.000	HES1_HUMAN Transcription factor HES-1 OS=Homo sapiens OX=9606 GN=HES1 PE=1 SV=1
4	Q6PBX3	1.38e-144	408	270	0.764	0.793	Q6PBX3_DANRE Hairy-related 6 OS=Danio rerio OX=7955 GN=HER-6 PE=2 SV=1
5	Q6IRB2	1.26e-142	403	267	0.768	0.805	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
6	Q90VV1	9.03e-112	325	277	0.657	0.664	HES4B_XENLA Transcription factor HES-4-B OS=Xenopus laevis OX=8355 GN=hes4-b PE=1 SV=1
7	Q90Z12	1.28e-110	322	281	0.650	0.648	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
8	Q9DF41	1.03e-109	320	291	0.639	0.615	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1
9	Q6XLQ0	1.41e-109	320	290	0.671	0.648	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
10	O57337	6.25e-108	316	290	0.650	0.628	HES1_CHICK Transcription factor HES-1 OS=Gallus gallus OX=9031 GN=HES1 PE=2 SV=1
11	Q9HCC6	4.03e-75	230	221	0.393	0.498	HES4_HUMAN Transcription factor HES-4 OS=Homo sapiens OX=9606 GN=HES4 PE=1 SV=1
12	Q26263	3.37e-48	167	435	0.339	0.218	DPN_DROME Protein deadpan OS=Drosophila melanogaster OX=7227 GN=dpn PE=1 SV=2
13	P14003	1.30e-40	145	337	0.339	0.282	HAIR_DROME Protein hairy OS=Drosophila melanogaster OX=7227 GN=hry PE=1 SV=2
14	Q00P32	1.80e-27	107	191	0.232	0.340	HES2_XENLA Transcription factor HES-2 OS=Xenopus laevis OX=8355 GN=hes2 PE=1 SV=2
15	P35429	8.84e-27	104	157	0.214	0.382	HES2_RAT Transcription factor HES-2 OS=Rattus norvegicus OX=10116 GN=Hes2 PE=2 SV=1
16	F1QI81	3.60e-26	104	221	0.200	0.253	F1QI81_DANRE Hairy-related 8a OS=Danio rerio OX=7955 GN=her-8a PE=4 SV=2
17	Q9Y543	5.77e-25	100	173	0.214	0.347	HES2_HUMAN Transcription factor HES-2 OS=Homo sapiens OX=9606 GN=HES2 PE=2 SV=1
18	Q6P0J1	1.42e-24	100	226	0.207	0.257	Q6P0J1_DANRE Hairy and enhancer of split 6 (Drosophila) OS=Danio rerio OX=7955 GN=her13.2 PE=1 SV=1
19	Q9UBP5	7.66e-24	100	337	0.200	0.166	HEY2_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Homo sapiens OX=9606 GN=HEY2 PE=1 SV=1
20	Q9I9L0	1.37e-23	99.8	324	0.186	0.160	HEY2_DANRE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07527 Hairy_orange	5e-16	70.0	Hairy Orange
2	PF00010 HLH	5.1e-12	56.9	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010371302.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010387954.1	0.949	Fanconi anemia complementation group E
2	61622.XP_010376667.1	0.933	Fanconi anemia complementation group A
3	61622.XP_010379353.1	0.933	Fanconi anemia group F protein
4	61622.XP_010384124.1	0.933	Fanconi anemia group G protein
5	61622.XP_010375971.1	0.929	Fanconi anemia complementation group L
6	61622.XP_010365306.1	0.927	Fanconi anemia-associated protein of 24 kDa
7	61622.XP_010352586.1	0.923	Fanconi anemia core complex associated protein 100
8	61622.XP_010370306.1	0.918	DNA repair protein that may operate in a postreplication repair or a cell cycle checkpoint function. May be implicated in interstrand DNA cross-link repair and in the maintenance of normal chromosome stability. Upon IFNG induction, may facilitate STAT1 activation by recruiting STAT1 to IFNGR1.
9	61622.XP_010351188.1	0.913	Fanconi anemia group B protein
10	61622.XP_010387597.1	0.910	Fanconi anemia group M protein
11	61622.XP_010362465.1	0.907	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 mRNAs, 81 ESTs, 7 Proteins, and 71% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
12	61622.XP_010377147.1	0.907	Belongs to the ubiquitin-conjugating enzyme family.
13	61622.XP_010351736.1	0.879	Transducin-like enhancer protein 1 isoform X1
14	61622.XP_010361952.1	0.857	Transducin-like enhancer protein 3 isoform X1
15	61622.XP_010372324.1	0.857	Transducin-like enhancer protein 4
16	61622.XP_010380325.1	0.826	Transcription factor HES-5
17	61622.XP_010371167.1	0.824	Notch 1
18	61622.XP_010376941.1	0.818	Fanconi anemia complementation group I
19	61622.XP_010373722.1	0.813	Sirtuin 1
20	61622.XP_010367687.1	0.811	Fanconi anemia group D2 protein isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046983	1.000	protein dimerization activity
GO:0042802	1.000	identical protein binding
GO:0140297	1.000	DNA-binding transcription factor binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.996	DNA-binding transcription factor activity
GO:0000976	0.989	transcription cis-regulatory region binding
GO:0000981	0.987	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.971	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001217	0.868	DNA-binding transcription repressor activity
GO:0001227	0.863	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0070888	0.857	E-box binding
GO:0042803	0.804	protein homodimerization activity
GO:0019899	0.789	enzyme binding
GO:0061629	0.671	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0042826	0.598	histone deacetylase binding
GO:0046982	0.525	protein heterodimerization activity
GO:0019904	0.460	protein domain specific binding
GO:0051087	0.424	chaperone binding
GO:0043425	0.330	bHLH transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051716	0.991	cellular response to stimulus
GO:0048519	0.991	negative regulation of biological process
GO:0007165	0.980	signal transduction
GO:0048523	0.973	negative regulation of cellular process
GO:0007166	0.973	cell surface receptor signaling pathway
GO:0032501	0.948	multicellular organismal process
GO:0019222	0.948	regulation of metabolic process
GO:0048856	0.946	anatomical structure development
GO:0060255	0.944	regulation of macromolecule metabolic process
GO:0007219	0.944	Notch signaling pathway
GO:0019219	0.938	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.932	regulation of gene expression
GO:0010556	0.929	regulation of macromolecule biosynthetic process
GO:0031326	0.929	regulation of cellular biosynthetic process
GO:0007275	0.927	multicellular organism development
GO:0006355	0.915	regulation of DNA-templated transcription
GO:0045934	0.891	negative regulation of nucleobase-containing compound metabolic process
GO:0010605	0.887	negative regulation of macromolecule metabolic process
GO:0006357	0.887	regulation of transcription by RNA polymerase II
GO:0000122	0.880	negative regulation of transcription by RNA polymerase II
GO:0048731	0.865	system development
GO:0045595	0.854	regulation of cell differentiation
GO:0051093	0.805	negative regulation of developmental process
GO:0048513	0.788	animal organ development
GO:0048518	0.787	positive regulation of biological process
GO:0019827	0.721	stem cell population maintenance
GO:0060284	0.703	regulation of cell development
GO:0007399	0.699	nervous system development
GO:0051239	0.639	regulation of multicellular organismal process
GO:0097150	0.624	neuronal stem cell population maintenance
GO:0048522	0.620	positive regulation of cellular process
GO:2000026	0.571	regulation of multicellular organismal development
GO:0010604	0.565	positive regulation of macromolecule metabolic process
GO:0051960	0.562	regulation of nervous system development
GO:0045596	0.554	negative regulation of cell differentiation
GO:0045664	0.524	regulation of neuron differentiation
GO:0051241	0.485	negative regulation of multicellular organismal process
GO:0051173	0.472	positive regulation of nitrogen compound metabolic process
GO:0045665	0.466	negative regulation of neuron differentiation
GO:0031325	0.433	positive regulation of cellular metabolic process
GO:0045935	0.420	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.416	positive regulation of biosynthetic process
GO:0010557	0.411	positive regulation of macromolecule biosynthetic process
GO:0031328	0.410	positive regulation of cellular biosynthetic process
GO:0009653	0.408	anatomical structure morphogenesis
GO:0045893	0.398	positive regulation of DNA-templated transcription
GO:0045944	0.325	positive regulation of transcription by RNA polymerase II
GO:0071704	0.309	organic substance metabolic process
GO:0050767	0.307	regulation of neurogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.970	protein-containing complex
GO:0043232	0.930	intracellular non-membrane-bounded organelle
GO:0005737	0.578	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]