StarFunc result for job id Q14494

User Input

>input (772 residues)
MLSLKKYLTEGLLQFTILLSLIGVRVDVDTYLTSQLPPLREIILGPSSAYTQTQFHNLRN
TLDGYGIHPKSIDLDNYFTARRLLSQVRALDRFQVPTTEVNAWLVHRDPEGSVSGSQPNS
GLALESSSGLQDVTGPDNGVRESETEQGFGEDLEDLGAVAPPVSGDLTKEDIDLIDILWR
QDIDLGAGREVFDYSHRQKEQDVEKELRDGGEQDTWAGEGAEALARNLLVDGETGESFPA
QVPSGEDQTALSLEECLRLLEATCPFGENAEFPADISSITEAVPSESEPPALQNNLLSPL
LTGTESPFDLEQQWQDLMSIMEMQAMEVNTSASEILYSAPPGDPLSTNYSLAPNTPINQN
VSLHQASLGGCSQDFLLFSPEVESLPVASSSTLLPLAPSNSTSLNSTFGSTNLTGLFFPP
QLNGTANDTAGPELPDPLGGLLDEAMLDEISLMDLAIEEGFNPVQASQLEEEFDSDSGLS
LDSSHSPSSLSSSEGSSSSSSSSSSSSSSASSSASSSFSEEGAVGYSSDSETLDLEEAEG
AVGYQPEYSKFCRMSYQDPAQLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSK
EKQADFLDKQMSRDEHRARAMKIPFTNDKIINLPVEEFNELLSKYQLSEAQLSLIRDIRR
RGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQE
VFGRLRDENGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14494	1.000	1.000	0.000	772	1.000	1.000	Q14494.pdb.gz	NF2L1_HUMAN Endoplasmic reticulum membrane sensor NFE2L1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
2	AFDB:Q61985	0.400	0.416	2.422E-96	741	0.933	0.972	Q61985.pdb.gz	NF2L1_MOUSE Endoplasmic reticulum membrane sensor NFE2L1 OS=Mus musculus OX=10090 GN=Nfe2l1 PE=1 SV=2
3	AFDB:P20482	0.203	0.116	8.774E-13	1383	0.219	0.122	P20482.pdb.gz	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
4	AFDB:O35464	0.054	0.042	1.608E-3	1031	0.093	0.070	O35464.pdb.gz	SEM6A_MOUSE Semaphorin-6A OS=Mus musculus OX=10090 GN=Sema6a PE=1 SV=2
5	AFDB:Q54WA7	0.048	0.047	1.062E-2	785	0.097	0.096	Q54WA7.pdb.gz	Q54WA7_DICDI RNA binding protein OS=Dictyostelium discoideum OX=44689 GN=pufA PE=4 SV=1
6	AFDB:Q9VEW6	0.048	0.043	2.728E-2	924	0.123	0.103	Q9VEW6.pdb.gz	Q9VEW6_DROME IP01015p OS=Drosophila melanogaster OX=7227 GN=pad PE=2 SV=2
7	AFDB:A0A384KX90	0.041	0.039	1.401E-1	820	0.111	0.105	A0A384KX90.pdb.gz	A0A384KX90_ARATH TRM7 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g53190 PE=1 SV=1
8	AFDB:A0A0R4IJ25	0.093	0.046	1.589E-1	1604	0.089	0.043	A0A0R4IJ25.pdb.gz
9	AFDB:Q9VGW1	0.057	0.029	2.043E-1	1943	0.101	0.040	Q9VGW1.pdb.gz	CAD86_DROME Cadherin-86C OS=Drosophila melanogaster OX=7227 GN=Cad86C PE=2 SV=3
10	AFDB:Q5JR59	0.079	0.048	2.176E-1	1369	0.142	0.080	Q5JR59.pdb.gz	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
11	PDB:7pntU	0.087	0.280	1.153	174	0.036	0.161	7pntU.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
12	PDB:1mzgA	0.039	0.150	1.393	144	0.013	0.069	1mzgA.pdb.gz
13	PDB:6hivCb	0.042	0.101	1.580	252	0.034	0.103	6hivCb.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:3j6bT	0.036	0.106	2.783	209	0.036	0.134	3j6bT.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
15	PDB:2w1tA	0.029	0.103	3.361	175	0.012	0.051	2w1tA.pdb.gz
16	PDB:6hiwDB	0.038	0.029	3.580	1111	0.014	0.010	6hiwDB.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
17	PDB:5ds9B	0.040	0.269	3.812	98	0.008	0.061	5ds9B.pdb.gz	DNA Sequence Determinants Controlling Affinity, Stability and Shape of DNA Complexes Bound by the Nucleoid Protein Fis.
18	PDB:7ktsF	0.039	0.073	3.812	351	0.030	0.066	7ktsF.pdb.gz
19	PDB:7l08AU	0.089	0.295	3.812	177	0.038	0.164	7l08AU.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
20	PDB:7qdsA	0.032	0.115	5.922	155	0.032	0.161	7qdsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DYE1	0.0	1142	584	0.741	0.979	B4DYE1_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
2	F5H1B7	0.0	1143	616	0.746	0.935	F5H1B7_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
3	J3QKY3	0.0	1119	573	0.727	0.979	J3QKY3_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
4	J9JIE5	0.0	1533	761	0.986	1.000	J9JIE5_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
5	Q14494	0.0	1565	772	1.000	1.000	NF2L1_HUMAN Endoplasmic reticulum membrane sensor NFE2L1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
6	Q61985	0.0	1438	741	0.934	0.973	NF2L1_MOUSE Endoplasmic reticulum membrane sensor NFE2L1 OS=Mus musculus OX=10090 GN=Nfe2l1 PE=1 SV=2
7	Q60795	6.10e-95	310	597	0.288	0.372	NF2L2_MOUSE Nuclear factor erythroid 2-related factor 2 OS=Mus musculus OX=10090 GN=Nfe2l2 PE=1 SV=2
8	O54968	9.16e-91	299	604	0.281	0.359	NF2L2_RAT Nuclear factor erythroid 2-related factor 2 OS=Rattus norvegicus OX=10116 GN=Nfe2l2 PE=1 SV=2
9	Q16236	9.30e-88	291	605	0.286	0.365	NF2L2_HUMAN Nuclear factor erythroid 2-related factor 2 OS=Homo sapiens OX=9606 GN=NFE2L2 PE=1 SV=3
10	K7EIW5	2.82e-87	290	604	0.284	0.363	K7EIW5_HUMAN NFE2 like bZIP transcription factor 2 OS=Homo sapiens OX=9606 GN=NFE2L2 PE=1 SV=2
11	Q8JIM1	4.24e-84	280	586	0.291	0.384	Q8JIM1_DANRE Nuclear factor erythroid 2-related factor 2 OS=Danio rerio OX=7955 GN=nrf2 PE=2 SV=1
12	Q9Y4A8	2.08e-82	279	694	0.250	0.278	NF2L3_HUMAN Nuclear factor erythroid 2-related factor 3 OS=Homo sapiens OX=9606 GN=NFE2L3 PE=1 SV=1
13	J3QQQ1	3.84e-70	229	161	0.153	0.733	J3QQQ1_HUMAN NFE2 like bZIP transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
14	Q9WTM4	3.99e-68	239	660	0.183	0.214	NF2L3_MOUSE Nuclear factor erythroid 2-related factor 3 OS=Mus musculus OX=10090 GN=Nfe2l3 PE=1 SV=1
15	Q07279	8.72e-56	197	373	0.201	0.416	NFE2_MOUSE Transcription factor NF-E2 45 kDa subunit OS=Mus musculus OX=10090 GN=Nfe2 PE=1 SV=1
16	Q16621	6.04e-55	195	373	0.162	0.335	NFE2_HUMAN Transcription factor NF-E2 45 kDa subunit OS=Homo sapiens OX=9606 GN=NFE2 PE=1 SV=1
17	Q7ZZR2	5.07e-46	172	419	0.122	0.224	Q7ZZR2_DANRE NFE2 OS=Danio rerio OX=7955 GN=nfe2 PE=2 SV=1
18	G8DKA8	3.36e-42	163	507	0.100	0.152	G8DKA8_DANRE Nrf2b OS=Danio rerio OX=7955 GN=Nrf2b PE=2 SV=1
19	F6TNN0	2.44e-40	162	922	0.113	0.094	F6TNN0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=nf-e2 PE=1 SV=2
20	P20482	3.08e-40	162	1383	0.102	0.057	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.0095	27.3	bZIP transcription factor
2	PF07716 bZIP_2	0.72	21.3	Basic region leucine zipper
3	PF03131 bZIP_Maf	6e-14	63.7	bZIP Maf transcription factor
4	PF09726 Macoilin	2.1e+02	11.9	Macoilin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354855

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350369	0.997	Transcription factor MafG
2	9606.ENSP00000171111	0.994	Kelch-like ECH-associated protein 1
3	9606.ENSP00000327048	0.966	Transcription factor Maf
4	9606.ENSP00000344903	0.919	Transcription factor MafK
5	9606.ENSP00000345393	0.913	Transcription factor MafF
6	9606.ENSP00000415556	0.868	DDB1- and CUL4-associated factor 11
7	9606.ENSP00000229416	0.766	Glutamate-cysteine ligase catalytic subunit
8	9606.ENSP00000413537	0.764	AP20 region protein 1
9	9606.ENSP00000485610	0.764	Chromosome 3 open reading frame 35
10	9606.ENSP00000264414	0.738	Cullin-3
11	9606.ENSP00000354487	0.700	Zinc finger E-box-binding homeobox 1
12	9606.ENSP00000336790	0.694	Cyclic AMP-dependent transcription factor ATF-4
13	9606.ENSP00000359258	0.690	Glutamate-cysteine ligase modifier subunit
14	9606.ENSP00000322956	0.684	Microfibril-associated glycoprotein 3
15	9606.ENSP00000359206	0.676	F-box/WD repeat-containing protein 1A
16	9606.ENSP00000376924	0.670	Nuclear respiratory factor 1
17	9606.ENSP00000394394	0.669	Anaphase-promoting complex subunit 7
18	9606.ENSP00000417748	0.669	DNA damage inducible 1 homolog 2
19	9606.ENSP00000438886	0.668	CDK5 regulatory subunit-associated protein 3
20	9606.ENSP00000324806	0.661	Glycogen synthase kinase-3 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001227	0.996	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0046983	0.995	protein dimerization activity
GO:0042802	0.979	identical protein binding
GO:0046982	0.979	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.995	regulation of DNA-templated transcription
GO:0009987	0.987	cellular process
GO:0008152	0.979	metabolic process
GO:0071704	0.959	organic substance metabolic process
GO:0048519	0.956	negative regulation of biological process
GO:0006807	0.950	nitrogen compound metabolic process
GO:0044237	0.944	cellular metabolic process
GO:0048523	0.944	negative regulation of cellular process
GO:1901564	0.923	organonitrogen compound metabolic process
GO:0006357	0.922	regulation of transcription by RNA polymerase II
GO:0010605	0.908	negative regulation of macromolecule metabolic process
GO:0045934	0.896	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.885	negative regulation of macromolecule biosynthetic process
GO:0031327	0.881	negative regulation of cellular biosynthetic process
GO:0051253	0.868	negative regulation of RNA metabolic process
GO:0045892	0.799	negative regulation of DNA-templated transcription
GO:0048518	0.746	positive regulation of biological process
GO:0032502	0.745	developmental process
GO:0009893	0.743	positive regulation of metabolic process
GO:0010604	0.734	positive regulation of macromolecule metabolic process
GO:0051173	0.714	positive regulation of nitrogen compound metabolic process
GO:0050896	0.686	response to stimulus
GO:0051716	0.684	cellular response to stimulus
GO:0048522	0.673	positive regulation of cellular process
GO:0009891	0.601	positive regulation of biosynthetic process
GO:0045935	0.597	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.592	positive regulation of RNA metabolic process
GO:0010557	0.587	positive regulation of macromolecule biosynthetic process
GO:0031328	0.587	positive regulation of cellular biosynthetic process
GO:0045893	0.584	positive regulation of DNA-templated transcription
GO:0006950	0.480	response to stress
GO:0000122	0.477	negative regulation of transcription by RNA polymerase II
GO:0042221	0.472	response to chemical
GO:0070887	0.431	cellular response to chemical stimulus
GO:0033554	0.379	cellular response to stress
GO:0044238	0.374	primary metabolic process
GO:0048856	0.341	anatomical structure development
GO:0043170	0.325	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016020	0.994	membrane
GO:0032991	0.993	protein-containing complex
GO:0012505	0.970	endomembrane system
GO:0005783	0.620	endoplasmic reticulum
GO:0005667	0.595	transcription regulator complex
GO:0031090	0.583	organelle membrane
GO:0140513	0.576	nuclear protein-containing complex
GO:0031984	0.558	organelle subcompartment
GO:0042175	0.556	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098827	0.553	endoplasmic reticulum subcompartment
GO:0005789	0.462	endoplasmic reticulum membrane
GO:0090575	0.326	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]