StarFunc result for job id Q14511

User Input

>input (834 residues)
MKYKNLMARALYDNVPECAEELAFRKGDILTVIEQNTGGLEGWWLCSLHGRQGIVPGNRV
KLLIGPMQETASSHEQPASGLMQQTFGQQKLYQVPNPQAAPRDTIYQVPPSYQNQGIYQV
PTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIP
PSHTTQGVYDIPPSSAKGPVFSVPVGEIKPQGVYDIPPTKGVYAIPPSACRDEAGLREKD
YDFPPPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPN
HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLHNPPDAKGSRD
LVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTAIERLQRLQQAL
EMGVSSLMALVTTDWRCYGYMERHINEIRTAVDKVELFLKEYLHFVKGAVANAACLPELI
LHNKMKRELQRVEDSHQILSQTSHDLNECSWSLNILAINKPQNKCDDLDRFVMVAKTVPD
DAKQLTTTINTNAEALFRPGPGSLHLKNGPESIMNSTEYPHGGSQGQLLHPGDHKAQAHN
KALPPGLSKEQAPDCSSSDGSERSWMDDYDYVHLQGKEEFERQQKELLEKENIMKQNKMQ
LEHHQLSQFQLLEQEITKPVENDISKWKPSQSLPTTNSGVSAQDRQLLCFYYDQCETHFI
SLLNAIDALFSCVSSAQPPRIFVAHSKFVILSAHKLVFIGDTLTRQVTAQDIRNKVMNSS
NQLCEQLKTIVMATKMAALHYPSTTALQEMVHQVTDLSRNAQLFKRSLLEMATF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024QZV9	0.257	0.257	1.708E-94	834	0.996	0.996	A0A024QZV9.pdb.gz
2	AFDB:O35177	0.266	0.266	2.832E-87	833	0.888	0.890	O35177.pdb.gz	CASL_MOUSE Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2
3	AFDB:F1NW90	0.268	0.270	3.867E-69	823	0.653	0.662	F1NW90.pdb.gz	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
4	AFDB:Q63767	0.271	0.238	4.887E-43	968	0.420	0.362	Q63767.pdb.gz	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
5	AFDB:A4IJ58	0.199	0.200	2.290E-33	831	0.245	0.245	A4IJ58.pdb.gz	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
6	AFDB:Q9NQ75	0.206	0.218	2.225E-30	786	0.264	0.280	Q9NQ75.pdb.gz	CASS4_HUMAN Cas scaffolding protein family member 4 OS=Homo sapiens OX=9606 GN=CASS4 PE=1 SV=2
7	AFDB:O43281	0.161	0.238	1.145E-16	561	0.225	0.335	O43281.pdb.gz	EFS_HUMAN Embryonal Fyn-associated substrate OS=Homo sapiens OX=9606 GN=EFS PE=1 SV=1
8	AFDB:Q64355	0.179	0.248	1.238E-15	560	0.216	0.321	Q64355.pdb.gz	EFS_MOUSE Embryonal Fyn-associated substrate OS=Mus musculus OX=10090 GN=Efs PE=1 SV=2
9	AFDB:M0R4F8	0.094	0.067	2.053E-8	1577	0.161	0.085	M0R4F8.pdb.gz	DNMBP_RAT Dynamin-binding protein OS=Rattus norvegicus OX=10116 GN=Dnmbp PE=1 SV=2
10	AFDB:Q6XZF7	0.118	0.078	2.675E-8	1577	0.145	0.077	Q6XZF7.pdb.gz	DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP PE=1 SV=1
11	PDB:2dybA	0.072	0.197	3.411E-3	298	0.022	0.060	2dybA.pdb.gz
12	PDB:3ehqA	0.067	0.287	4.445E-3	182	0.022	0.099	3ehqA.pdb.gz
13	PDB:1griA	0.068	0.259	6.610E-3	211	0.023	0.090	1griA.pdb.gz
14	PDB:1k9aB	0.065	0.121	9.000E-3	441	0.020	0.039	1k9aB.pdb.gz
15	PDB:2lqnA	0.070	0.180	1.027E-2	303	0.024	0.066	2lqnA.pdb.gz
16	PDB:3qwyA	0.068	0.316	1.027E-2	170	0.018	0.088	3qwyA.pdb.gz
17	PDB:2h8hA	0.061	0.111	1.338E-2	445	0.025	0.047	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
18	PDB:6nr7A	0.104	0.084	1.462E-2	1086	0.061	0.047	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
19	PDB:2eyzA	0.070	0.180	4.600E-2	304	0.028	0.076	2eyzA.pdb.gz
20	PDB:1tr2B	0.125	0.102	4.808E-2	1029	0.060	0.049	1tr2B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WUD2	0.0	1422	685	0.818	0.996	A0A087WUD2_HUMAN Neural precursor cell expressed, developmentally down-regulated 9 OS=Homo sapiens OX=9606 GN=NEDD9 PE=1 SV=1
2	A0A8I3PDQ1	0.0	1528	834	0.891	0.891	CASL_CANLF Enhancer of filamentation 1 OS=Canis lupus familiaris OX=9615 GN=NEDD9 PE=1 SV=1
3	F1NW90	0.0	1058	823	0.661	0.670	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
4	O35177	0.0	1498	833	0.888	0.890	CASL_MOUSE Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2
5	Q14511	0.0	1741	834	1.000	1.000	CASL_HUMAN Enhancer of filamentation 1 OS=Homo sapiens OX=9606 GN=NEDD9 PE=1 SV=1
6	Q6P5Z4	1.91e-163	499	870	0.446	0.428	Q6P5Z4_HUMAN Breast cancer anti-estrogen resistance 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=2 SV=1
7	P56945	3.19e-163	498	870	0.448	0.430	BCAR1_HUMAN Breast cancer anti-estrogen resistance protein 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=1 SV=2
8	Q63767	1.33e-162	499	968	0.447	0.385	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
9	Q61140	3.94e-161	493	874	0.444	0.423	BCAR1_MOUSE Breast cancer anti-estrogen resistance protein 1 OS=Mus musculus OX=10090 GN=Bcar1 PE=1 SV=2
10	Q9YHC0	7.58e-128	387	316	0.241	0.636	Q9YHC0_CHICK Enhancer of filamentation 1 homolog (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
11	Q9NQ75	3.49e-68	243	786	0.291	0.309	CASS4_HUMAN Cas scaffolding protein family member 4 OS=Homo sapiens OX=9606 GN=CASS4 PE=1 SV=2
12	B7Z0H1	1.07e-43	169	567	0.143	0.210	B7Z0H1_DROME P130CAS, isoform E OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=4 SV=1
13	Q95U71	1.22e-43	169	568	0.143	0.210	Q95U71_DROME GH02705p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=2 SV=1
14	A4IJ58	6.20e-43	170	831	0.143	0.143	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
15	Q7KVE5	7.20e-43	169	793	0.143	0.150	Q7KVE5_DROME Crk-associated substrate OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=2 SV=1
16	O43281	1.40e-29	126	561	0.089	0.132	EFS_HUMAN Embryonal Fyn-associated substrate OS=Homo sapiens OX=9606 GN=EFS PE=1 SV=1
17	Q64355	5.05e-22	103	560	0.077	0.114	EFS_MOUSE Embryonal Fyn-associated substrate OS=Mus musculus OX=10090 GN=Efs PE=1 SV=2
18	P34109	9.10e-08	58.5	1109	0.032	0.024	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2
19	Q55CW4	4.25e-07	55.5	364	0.030	0.069	Q55CW4_DICDI SH3 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269874 PE=4 SV=1
20	F8W7U0	6.33e-07	55.8	1149	0.052	0.037	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12026 CAS_C	1.3e-79	278.5	Crk-Associated Substrate C-terminal domain
2	PF08824 Serine_rich	8.4e-55	196.6	Serine rich protein interaction domain
3	PF00018 SH3_1	2.4e-07	41.5	SH3 domain
4	PF07653 SH3_2	4.3e-07	41.0	Variant SH3 domain
5	PF14604 SH3_9	3.5e-09	47.8	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368759

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300574	0.998	Adapter molecule crk
2	9606.ENSP00000346300	0.997	Crk-like protein
3	9606.ENSP00000359264	0.989	Breast cancer anti-estrogen resistance protein 3
4	9606.ENSP00000351664	0.988	[F-actin]-monooxygenase MICAL1
5	9606.ENSP00000216911	0.987	Aurora kinase A
6	9606.ENSP00000341189	0.984	Focal adhesion kinase 1
7	9606.ENSP00000266037	0.977	Dedicator of cytokinesis protein 3
8	9606.ENSP00000332973	0.976	Mothers against decapentaplegic homolog 3
9	9606.ENSP00000380638	0.935	Protein-tyrosine kinase 2-beta
10	9606.ENSP00000200457	0.928	Thyroid receptor-interacting protein 6
11	9606.ENSP00000361263	0.880	Rap guanine nucleotide exchange factor 1
12	9606.ENSP00000267257	0.866	Paxillin
13	9606.ENSP00000362680	0.851	Proto-oncogene tyrosine-protein kinase Src
14	9606.ENSP00000346671	0.807	Tyrosine-protein kinase Fyn
15	9606.ENSP00000324422	0.804	Zyxin
16	9606.ENSP00000248594	0.775	Tyrosine-protein phosphatase non-receptor type 12
17	9606.ENSP00000451828	0.752	RAC-alpha serine/threonine-protein kinase
18	9606.ENSP00000361423	0.743	Tyrosine-protein kinase ABL1
19	9606.ENSP00000234091	0.711	DNA-binding protein inhibitor ID-2
20	9606.ENSP00000417273	0.695	Cytoplasmic protein NCK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.655	enzyme binding
GO:0019900	0.507	kinase binding
GO:0019901	0.426	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.995	cellular process
GO:0048522	0.986	positive regulation of cellular process
GO:0071840	0.967	cellular component organization or biogenesis
GO:0016043	0.961	cellular component organization
GO:0040012	0.959	regulation of locomotion
GO:0030335	0.941	positive regulation of cell migration
GO:0050896	0.932	response to stimulus
GO:0065009	0.925	regulation of molecular function
GO:0030155	0.903	regulation of cell adhesion
GO:0048519	0.888	negative regulation of biological process
GO:0048523	0.844	negative regulation of cellular process
GO:0051716	0.837	cellular response to stimulus
GO:0007154	0.815	cell communication
GO:0023052	0.813	signaling
GO:0019222	0.809	regulation of metabolic process
GO:0044093	0.791	positive regulation of molecular function
GO:0007165	0.746	signal transduction
GO:0006996	0.735	organelle organization
GO:0060255	0.679	regulation of macromolecule metabolic process
GO:0043085	0.660	positive regulation of catalytic activity
GO:0031323	0.560	regulation of cellular metabolic process
GO:0051171	0.556	regulation of nitrogen compound metabolic process
GO:0009893	0.555	positive regulation of metabolic process
GO:0080090	0.554	regulation of primary metabolic process
GO:0031325	0.540	positive regulation of cellular metabolic process
GO:0010604	0.538	positive regulation of macromolecule metabolic process
GO:0051173	0.533	positive regulation of nitrogen compound metabolic process
GO:0051246	0.509	regulation of protein metabolic process
GO:0048583	0.474	regulation of response to stimulus
GO:0051128	0.433	regulation of cellular component organization
GO:0007166	0.421	cell surface receptor signaling pathway
GO:0048870	0.369	cell motility
GO:0048584	0.356	positive regulation of response to stimulus
GO:0051247	0.334	positive regulation of protein metabolic process
GO:0031399	0.326	regulation of protein modification process
GO:0051239	0.321	regulation of multicellular organismal process
GO:0023051	0.313	regulation of signaling
GO:0045937	0.308	positive regulation of phosphate metabolic process
GO:0031401	0.303	positive regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005829	1.000	cytosol
GO:0005634	1.000	nucleus
GO:0005654	0.990	nucleoplasm
GO:0043232	0.980	intracellular non-membrane-bounded organelle
GO:0005856	0.892	cytoskeleton
GO:0030054	0.740	cell junction
GO:0015630	0.647	microtubule cytoskeleton
GO:0005819	0.564	spindle
GO:0070161	0.544	anchoring junction
GO:0030055	0.488	cell-substrate junction
GO:0005925	0.469	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]