StarFunc result for job id Q14517

User Input

>input (1400 residues)
MGRHLALLLLLLLLFQHFGDSDGSQRLEQTPLQFTHLEYNVTVQENSAAKTYVGHPVKMG
VYITHPAWEVRYKIVSGDSENLFKAEEYILGDFCFLRIRTKGGNTAILNREVKDHYTLIV
KALEKNTNVEARTKVRVQVLDTNDLRPLFSPTSYSVSLPENTAIRTSIARVSATDADIGT
NGEFYYSFKDRTDMFAIHPTSGVIVLTGRLDYLETKLYEMEILAADRGMKLYGSSGISSM
AKLTVHIEQANECAPVITAVTLSPSELDRDPAYAIVTVDDCDQGANGDIASLSIVAGDLL
QQFRTVRSFPGSKEYKVKAIGGIDWDSHPFGYNLTLQAKDKGTPPQFSSVKVIHVTSPQF
KAGPVKFEKDVYRAEISEFAPPNTPVVMVKAIPAYSHLRYVFKSTPGKAKFSLNYNTGLI
SILEPVKRQQAAHFELEVTTSDRKASTKVLVKVLGANSNPPEFTQTAYKAAFDENVPIGT
TVMSLSAVDPDEGENGYVTYSIANLNHVPFAIDHFTGAVSTSENLDYELMPRVYTLRIRA
SDWGLPYRREVEVLATITLNNLNDNTPLFEKINCEGTIPRDLGVGEQITTVSAIDADELQ
LVQYQIEAGNELDFFSLNPNSGVLSLKRSLMDGLGAKVSFHSLRITATDGENFATPLYIN
ITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTL
PTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGMLKILSPL
DRETTDKYTLNITVYDLGIPQKAAWRLLHVVVVDANDNPPEFLQESYFVEVSEDKEVHSE
IIQVEATDKDLGPNGHVTYSIVTDTDTFSIDSVTGVVNIARPLDRELQHEHSLKIEARDQ
AREEPQLFSTVVVKVSLEDVNDNPPTFIPPNYRVKVREDLPEGTVIMWLEAHDPDLGQSG
QVRYSLLDHGEGNFDVDKLSGAVRIVQQLDFEKKQVYNLTVRAKDKGKPVSLSSTCYVEV
EVVDVNENLHPPVFSSFVEKGTVKEDAPVGSLVMTVSAHDEDARRDGEIRYSIRDGSGVG
VFKIGEETGVIETSDRLDRESTSHYWLTVFATDQGVVPLSSFIEIYIEVEDVNDNAPQTS
EPVYYPEIMENSPKDVSVVQIEAFDPDSSSNDKLMYKITSGNPQGFFSIHPKTGLITTTS
RKLDREQQDEHILEVTVTDNGSPPKSTIARVIVKILDENDNKPQFLQKFYKIRLPEREKP
DRERNARREPLYHVIATDKDEGPNAEISYSIEDGNEHGKFFIEPKTGVVSSKRFSAAGEY
DILSIKAVDNGRPQKSSTTRLHIEWISKPKPSLEPISFEESFFTFTVMESDPVAHMIGVI
SVEPPGIPLWFDITGGNYDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q08C65	0.212	0.320	9.016E-83	847	0.258	0.426	Q08C65.pdb.gz
2	AFDB:A0A0R4IZF0	0.143	0.106	1.141E-82	1907	0.227	0.167	A0A0R4IZF0.pdb.gz
3	AFDB:Q99PJ1	0.141	0.103	7.221E-81	1943	0.228	0.164	Q99PJ1.pdb.gz	PCD15_MOUSE Protocadherin-15 OS=Mus musculus OX=10090 GN=Pcdh15 PE=1 SV=3
4	AFDB:Q5ICW6	0.143	0.115	5.227E-80	1796	0.237	0.185	Q5ICW6.pdb.gz	Q5ICW6_DANRE Protocadherin 15a OS=Danio rerio OX=7955 GN=PCDH15 PE=2 SV=1
5	AFDB:Q9VFH5	0.159	0.117	4.569E-79	1981	0.249	0.176	Q9VFH5.pdb.gz	Q9VFH5_DROME Cadherin 88C OS=Drosophila melanogaster OX=7227 GN=Cad88C PE=4 SV=3
6	AFDB:Q9VVG0	0.163	0.133	2.164E-78	1820	0.233	0.179	Q9VVG0.pdb.gz	Q9VVG0_DROME Cadherin 74A, isoform A OS=Drosophila melanogaster OX=7227 GN=Cad74A PE=2 SV=1
7	AFDB:Q9VAF5	0.180	0.150	2.758E-77	1706	0.208	0.171	Q9VAF5.pdb.gz	CAD99_DROME Cadherin-99C OS=Drosophila melanogaster OX=7227 GN=Cad99C PE=1 SV=2
8	AFDB:Q0ZM14	0.133	0.100	9.981E-75	1899	0.235	0.173	Q0ZM14.pdb.gz	PCD15_CHICK Protocadherin-15 OS=Gallus gallus OX=9031 GN=Pcdh15 PE=1 SV=1
9	AFDB:Q96QU1	0.149	0.109	1.455E-74	1955	0.230	0.165	Q96QU1.pdb.gz	PCD15_HUMAN Protocadherin-15 OS=Homo sapiens OX=9606 GN=PCDH15 PE=1 SV=2
10	AFDB:G5EDK5	0.145	0.088	1.746E-68	2596	0.204	0.110	G5EDK5.pdb.gz	CELR_CAEEL Cadherin EGF LAG seven-pass G-type receptor fmi-1 OS=Caenorhabditis elegans OX=6239 GN=fmi-1 PE=1 SV=1
11	PDB:7sqcO0	0.085	0.098	1.319E-17	1140	0.079	0.096	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:6velC	0.121	0.694	1.176E-13	209	0.044	0.292	6velC.pdb.gz	Regulation of multiple dimeric states of E-cadherin by adhesion activating antibodies revealed through Cryo-EM and X-ray crystallography.
13	PDB:4aq1A	0.078	0.133	1.510E-11	721	0.073	0.141	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
14	PDB:5oj2B	0.102	0.178	3.364E-11	692	0.067	0.136	5oj2B.pdb.gz
15	PDB:1e07A	0.097	0.182	3.526E-11	642	0.068	0.148	1e07A.pdb.gz
16	PDB:5a42A	0.067	0.061	6.596E-9	1597	0.098	0.086	5a42A.pdb.gz
17	PDB:7q5zA	0.071	0.073	6.336E-8	1344	0.085	0.089	7q5zA.pdb.gz
18	PDB:7nycA	0.066	0.061	8.019E-8	1542	0.071	0.064	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
19	PDB:4ziqA	0.058	0.056	9.683E-8	1450	0.082	0.079	4ziqA.pdb.gz
20	PDB:7q1yA	0.078	0.078	6.085E-7	1374	0.067	0.068	7q1yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WRT4	0.0	2522	4602	0.874	0.266	A0A087WRT4_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=2
2	A0A1L1SQU7	0.0	2512	4645	0.870	0.262	A0A1L1SQU7_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
3	A0A2R8QAL3	0.0	1466	4601	0.538	0.164	A0A2R8QAL3_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
4	A2BGT8	0.0	2013	4611	0.676	0.205	A2BGT8_DANRE FAT atypical cadherin 1a OS=Danio rerio OX=7955 GN=fat PE=1 SV=1
5	F1QA09	0.0	1472	4546	0.540	0.166	F1QA09_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=2
6	F2Z4A3	0.0	2522	4590	0.874	0.266	F2Z4A3_MOUSE FAT atypical cadherin 1 OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
7	O88277	0.0	1321	4351	0.470	0.151	FAT2_RAT Protocadherin Fat 2 OS=Rattus norvegicus OX=10116 GN=Fat2 PE=1 SV=1
8	Q14517	0.0	2885	4588	1.000	0.305	FAT1_HUMAN Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2
9	Q8BNA6	0.0	1619	4555	0.591	0.182	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2
10	Q9NYQ8	0.0	1335	4349	0.472	0.152	FAT2_HUMAN Protocadherin Fat 2 OS=Homo sapiens OX=9606 GN=FAT2 PE=1 SV=2
11	Q9QXA3	0.0	2521	4587	0.873	0.266	Q9QXA3_MOUSE Fat 1 cadherin (Fragment) OS=Mus musculus OX=10090 GN=Fat1 PE=1 SV=1
12	Q9VW71	0.0	915	4699	0.393	0.117	FAT2_DROME Fat-like cadherin-related tumor suppressor homolog OS=Drosophila melanogaster OX=7227 GN=kug PE=2 SV=3
13	Q9WU10	0.0	2523	4589	0.876	0.267	Q9WU10_RAT Protocadherin OS=Rattus norvegicus OX=10116 GN=Fat1 PE=2 SV=1
14	X1WCY4	0.0	1471	4578	0.540	0.165	X1WCY4_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
15	Q6V0I7	1.15e-129	447	4981	0.297	0.084	FAT4_HUMAN Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4 PE=1 SV=2
16	Q2PZL6	3.70e-127	440	4981	0.284	0.080	FAT4_MOUSE Protocadherin Fat 4 OS=Mus musculus OX=10090 GN=Fat4 PE=1 SV=2
17	Q6QQE1	1.02e-119	417	3366	0.284	0.118	Q6QQE1_DANRE Cadherin 23 OS=Danio rerio OX=7955 GN=cdh23 PE=1 SV=1
18	Q24292	1.64e-113	399	3503	0.254	0.101	DS_DROME Protein dachsous OS=Drosophila melanogaster OX=7227 GN=ds PE=1 SV=3
19	X2J8E9	2.95e-113	398	3556	0.254	0.100	X2J8E9_DROME Dachsous, isoform B OS=Drosophila melanogaster OX=7227 GN=ds PE=4 SV=1
20	Q9H251	6.37e-107	378	3354	0.254	0.106	CAD23_HUMAN Cadherin-23 OS=Homo sapiens OX=9606 GN=CDH23 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00028 Cadherin	4.6e-182	602.4	Cadherin domain
2	PF08266 Cadherin_2	8.6e-07	40.0	Cadherin-like
3	PF17756 RET_CLD1	19	17.0	RET Cadherin like domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000406229

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398698	0.931	Tumor necrosis factor
2	9606.ENSP00000479618	0.929	Myc proto-oncogene protein
3	9606.ENSP00000385523	0.920	Peroxisome proliferator-activated receptor alpha
4	9606.ENSP00000325819	0.913	COUP transcription factor 1
5	9606.ENSP00000360266	0.911	Transcription factor AP-1
6	9606.ENSP00000216797	0.905	NF-kappa-B inhibitor alpha
7	9606.ENSP00000384273	0.905	Transcription factor p65
8	9606.ENSP00000327251	0.904	Nitric oxide synthase, inducible
9	9606.ENSP00000419692	0.903	Retinoic acid receptor RXR-alpha
10	9606.ENSP00000329357	0.901	Transcription factor Sp1
11	9606.ENSP00000254227	0.900	Nuclear receptor subfamily 0 group B member 2
12	9606.ENSP00000354876	0.900	Cytochrome c oxidase subunit 2
13	9606.ENSP00000400223	0.899	Four-jointed box protein 1
14	9606.ENSP00000344456	0.898	Catenin beta-1
15	9606.ENSP00000355809	0.816	Protein enabled homolog
16	9606.ENSP00000258341	0.796	Laminin subunit gamma-1
17	9606.ENSP00000245932	0.788	Vasodilator-stimulated phosphoprotein
18	9606.ENSP00000302811	0.770	Melatonin receptor type 1A
19	9606.ENSP00000478927	0.752	Transcriptional coactivator YAP1
20	9606.ENSP00000257068	0.669	Melatonin receptor type 1B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009653	0.977	anatomical structure morphogenesis
GO:0009987	0.905	cellular process
GO:0048880	0.872	sensory system development
GO:0048513	0.870	animal organ development
GO:0001654	0.809	eye development
GO:0090596	0.776	sensory organ morphogenesis
GO:0007155	0.768	cell adhesion
GO:0043010	0.766	camera-type eye development
GO:0009888	0.711	tissue development
GO:0061339	0.650	establishment or maintenance of monopolar cell polarity
GO:0061162	0.635	establishment of monopolar cell polarity
GO:0045197	0.635	establishment or maintenance of epithelial cell apical/basal polarity
GO:0090162	0.634	establishment of epithelial cell polarity
GO:0002088	0.621	lens development in camera-type eye
GO:0045198	0.621	establishment of epithelial cell apical/basal polarity
GO:0003382	0.591	epithelial cell morphogenesis
GO:0048593	0.557	camera-type eye morphogenesis
GO:0030029	0.519	actin filament-based process
GO:0097435	0.518	supramolecular fiber organization
GO:0030036	0.501	actin cytoskeleton organization
GO:0098609	0.421	cell-cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0016020	0.994	membrane
GO:0071944	0.976	cell periphery
GO:0005886	0.963	plasma membrane
GO:0043226	0.871	organelle
GO:0005622	0.817	intracellular anatomical structure
GO:0031252	0.809	cell leading edge
GO:0030054	0.797	cell junction
GO:0030027	0.778	lamellipodium
GO:0030175	0.729	filopodium
GO:0043227	0.720	membrane-bounded organelle
GO:0016324	0.688	apical plasma membrane
GO:0005737	0.598	cytoplasm
GO:0043229	0.568	intracellular organelle
GO:0043231	0.560	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]