StarFunc result for job id Q14524

User Input

>input (2016 residues)
MANFLLPRGTSSFRRFTRESLAAIEKRMAEKQARGSTTLQESREGLPEEEAPRPQLDLQA
SKKLPDLYGNPPQELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNALYVLSPFHPI
RRAAVKILVHSLFNMLIMCTILTNCVFMAQHDPPPWTKYVEYTFTAIYTFESLVKILARG
FCLHAFTFLRDPWNWLDFSVIIMAYTTEFVDLGNVSALRTFRVLRALKTISVISGLKTIV
GALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNLRHKCVRNFTALNGTNGSVEADGLV
WESLDLYLSDPENYLLKNGTSDVLLCGNSSDAGTCPEGYRCLKAGENPDHGYTSFDSFAW
AFLALFRLMTQDCWERLYQQTLRSAGKIYMIFFMLVIFLGSFYLVNLILAVVAMAYEEQN
QATIAETEEKEKRFQEAMEMLKKEHEALTIRGVDTVSRSSLEMSPLAPVNSHERRSKRRK
RMSSGTEECGEDRLPKSDSEDGPRAMNHLSLTRGLSRTSMKPRSSRGSIFTFRRRDLGSE
ADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALHGKKNSTVDCNGV
VSLLGAGDPEATSPGSHLLRPVMLEHPPDTTTPSEEPGGPQMLTSQAPCVDGFEEPGARQ
RALSAVSVLTSALEELEESRHKCPPCWNRLAQRYLIWECCPLWMSIKQGVKLVVMDPFTD
LTITMCIVLNTLFMALEHYNMTSEFEEMLQVGNLVFTGIFTAEMTFKIIALDPYYYFQQG
WNIFDSIIVILSLMELGLSRMSNLSVLRSFRLLRVFKLAKSWPTLNTLIKIIGNSVGALG
NLTLVLAIIVFIFAVVGMQLFGKNYSELRDSDSGLLPRWHMMDFFHAFLIIFRILCGEWI
ETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLFLALLLSSFSADNLTAPDEDREMNNLQ
LALARIQRGLRFVKRTTWDFCCGLLRQRPQKPAALAAQGQLPSCIATPYSPPPPETEKVP
PTRKETRFEEGEQPGQGTPGDPEPVCVPIAVAESDTDDQEEDEENSLGTEEESSKQQESQ
PVSGGPEAPPDSRTWSQVSATASSEAEASASQADWRQQWKAEPQAPGCGETPEDSCSEGS
TADMTNTAELLEQIPDLGQDVKDPEDCFTEGCVRRCPCCAVDTTQAPGKVWWRLRKTCYH
IVEHSWFETFIIFMILLSSGALAFEDIYLEERKTIKVLLEYADKMFTYVFVLEMLLKWVA
YGFKKYFTNAWCWLDFLIVDVSLVSLVANTLGFAEMGPIKSLRTLRALRPLRALSRFEGM
RVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNN
KSQCESLNLTGELYWTKVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVDSRGYEEQPQW
EYNLYMYIYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKK
LGSKKPQKPIPRPLNKYQGFIFDIVTKQAFDVTIMFLICLNMVTMMVETDDQSPEKINIL
AKINLLFVAIFTGECIVKLAALRHYYFTNSWNIFDFVVVILSIVGTVLSDIIQKYFFSPT
LFRVIRLARIGRILRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMANFA
YVKWEAGIDDMFNFQTFANSMLCLFQITTSAGWDGLLSPILNTGPPYCDPTLPNSNGSRG
DCGSPAVGILFFTTYIIISFLIVVNMYIAIILENFSVATEESTEPLSEDDFDMFYEIWEK
FDPEATQFIEYSVLSDFADALSEPLRIAKPNQISLINMDLPMVSGDRIHCMDILFAFTKR
VLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAMVIQRAFRRHLLQRS
LKHASFLFRQQAGSGLSEEDAPEREGLIAYVMSENFSRPLGPPSSSSISSTSFPPSYDSV
TRATSDNLQVRGSDYSHSEDLADFPPSPDRDRESIV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6lqaB	0.561	0.975	0.000	1151	0.571	1.000	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
2	PDB:6uz3A	0.544	0.966	0.000	1126	0.542	0.970	6uz3A.pdb.gz	Structure of the Cardiac Sodium Channel.
3	PDB:7w9lA	0.637	0.896	0.000	1420	0.525	0.746	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
4	PDB:7xveA	0.582	0.899	0.000	1276	0.465	0.735	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
5	AFDB:A0A0G2KYI1	0.787	0.812	0.000	1954	0.648	0.668	A0A0G2KYI1.pdb.gz
6	AFDB:A0A0R4IUM7	0.794	0.818	0.000	1955	0.574	0.592	A0A0R4IUM7.pdb.gz	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
7	AFDB:A0A2R8QLY1	0.763	0.788	0.000	1949	0.617	0.638	A0A2R8QLY1.pdb.gz
8	AFDB:B1AWN6	0.772	0.776	0.000	2006	0.630	0.634	B1AWN6.pdb.gz	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
9	AFDB:B1AYL1	0.678	0.808	0.000	1681	0.374	0.449	B1AYL1.pdb.gz	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
10	AFDB:F1LQQ7	0.686	0.806	0.000	1704	0.372	0.440	F1LQQ7.pdb.gz	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
11	AFDB:F1QXF5	0.790	0.797	0.000	1996	0.623	0.629	F1QXF5.pdb.gz	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
12	AFDB:F1R3Q5	0.784	0.817	0.000	1932	0.633	0.661	F1R3Q5.pdb.gz
13	AFDB:P08104	0.767	0.792	0.000	1951	0.619	0.639	P08104.pdb.gz	SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn3a PE=1 SV=1
14	AFDB:P15389	0.845	0.844	0.000	2019	0.941	0.940	P15389.pdb.gz	SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn5a PE=1 SV=1
15	PDB:6j8eA	0.550	0.968	3.308E-103	1139	0.451	0.798	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
16	PDB:7we4A	0.539	0.959	1.511E-102	1122	0.423	0.760	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
17	PDB:6agfA	0.554	0.974	6.314E-101	1138	0.444	0.787	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.
18	PDB:6j8gA	0.547	0.958	3.012E-100	1140	0.432	0.763	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
19	PDB:7tj9A	0.528	0.947	3.706E-78	1111	0.301	0.545	7tj9A.pdb.gz	Structure-guided unlocking of Na X reveals a non-selective tetrodotoxin-sensitive cation channel.
20	PDB:7mixA	0.533	0.795	2.449E-50	1326	0.187	0.284	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT39	4019	1962	0.972	0.998	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
2	A0A0R4IUM7	2162	1955	0.582	0.601	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	A0A1B0GVX7	1156	1618	0.324	0.404	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
4	A0A1W2PPJ3	1150	1998	0.322	0.325	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
5	A0A286YEQ8	1161	1915	0.324	0.341	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
6	A0A286YF26	1150	1997	0.323	0.326	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
7	A0A590UK43	2243	1939	0.611	0.635	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
8	A0A8I6GH51	1026	1672	0.276	0.333	A0A8I6GH51_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=3 SV=1
9	A2APX8	2409	2009	0.630	0.633	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
10	A2ASI5	2335	1947	0.628	0.650	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
11	B1AWN6	2439	2006	0.642	0.646	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	B1AYL1	1071	1681	0.283	0.340	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	E9PG18	4114	1998	0.988	0.996	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	E9PHB6	4071	1983	0.980	0.996	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	F1LQQ7	1039	1680	0.277	0.332	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
16	F1QXF5	2405	1996	0.640	0.646	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
17	H9KVD2	4165	2016	0.997	0.997	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
18	K4DIA1	4007	1962	0.968	0.995	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	O08562	1108	1984	0.299	0.303	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
20	O88420	2338	1978	0.630	0.643	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20077 CcmD_alt	3.8e+02	12.6	CcmD family protein
2	PF16905 GPHH	4.6	18.5	Voltage-dependent L-type calcium channel, IQ-associated
3	PF00520 Ion_trans	2.9e-250	837.3	Ion transport protein
4	PF00612 IQ	63	14.8	IQ calmodulin-binding motif
5	PF06512 Na_trans_assoc	1.3e-61	220.0	Sodium ion transport-associated
6	PF11933 Na_trans_cytopl	6e-44	161.7	Cytoplasmic domain of voltage-gated Na+ ion channel
7	PF08016 PKD_channel	1.7e-12	58.8	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000410257

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280772	0.996	Ankyrin-3
2	9606.ENSP00000349467	0.993	Calmodulin-1
3	9606.ENSP00000291295	0.992	Calmodulin 3 (phosphorylase kinase, delta)
4	9606.ENSP00000345731	0.988	Disks large homolog 1
5	9606.ENSP00000354923	0.987	Dystrophin
6	9606.ENSP00000217381	0.985	Alpha-1-syntrophin
7	9606.ENSP00000282561	0.985	Gap junction alpha-1 protein
8	9606.ENSP00000070846	0.984	Plakophilin-2
9	9606.ENSP00000396915	0.973	Sodium channel subunit beta-1
10	9606.ENSP00000322460	0.965	Sodium channel subunit beta-4
11	9606.ENSP00000262186	0.960	Potassium voltage-gated channel subfamily H member 2
12	9606.ENSP00000376523	0.957	Sodium channel subunit beta-3
13	9606.ENSP00000413496	0.954	Fibroblast growth factor 12
14	9606.ENSP00000278947	0.953	Sodium channel subunit beta-2
15	9606.ENSP00000272298	0.943	Calmodulin 2 (phosphorylase kinase, delta)
16	9606.ENSP00000349588	0.928	Ankyrin-2
17	9606.ENSP00000243457	0.912	Inward rectifier potassium channel 2
18	9606.ENSP00000226105	0.910	Ran guanine nucleotide release factor
19	9606.ENSP00000322390	0.906	Fibroblast growth factor 13
20	9606.ENSP00000337255	0.901	Potassium voltage-gated channel subfamily E member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0005515	0.997	protein binding
GO:0022836	0.561	gated channel activity
GO:0022839	0.553	monoatomic ion gated channel activity
GO:0005244	0.354	voltage-gated monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051179	0.996	localization
GO:0044057	0.996	regulation of system process
GO:0009987	0.994	cellular process
GO:0032501	0.993	multicellular organismal process
GO:0065008	0.991	regulation of biological quality
GO:0030001	0.990	metal ion transport
GO:0008016	0.990	regulation of heart contraction
GO:0006814	0.983	sodium ion transport
GO:0050794	0.980	regulation of cellular process
GO:0042391	0.980	regulation of membrane potential
GO:0002027	0.978	regulation of heart rate
GO:0061337	0.965	cardiac conduction
GO:0035725	0.964	sodium ion transmembrane transport
GO:0006942	0.961	regulation of striated muscle contraction
GO:0001508	0.958	action potential
GO:0050896	0.947	response to stimulus
GO:0055117	0.945	regulation of cardiac muscle contraction
GO:0003008	0.939	system process
GO:0086065	0.895	cell communication involved in cardiac conduction
GO:0003254	0.872	regulation of membrane depolarization
GO:0086001	0.869	cardiac muscle cell action potential
GO:1903115	0.867	regulation of actin filament-based movement
GO:0086004	0.841	regulation of cardiac muscle cell contraction
GO:0042221	0.702	response to chemical
GO:0048856	0.575	anatomical structure development
GO:0048518	0.478	positive regulation of biological process
GO:0007275	0.476	multicellular organism development
GO:0023052	0.456	signaling
GO:0051049	0.448	regulation of transport
GO:0043269	0.400	regulation of monoatomic ion transport
GO:0051716	0.399	cellular response to stimulus
GO:0003013	0.366	circulatory system process
GO:0006936	0.346	muscle contraction
GO:0010033	0.334	response to organic substance
GO:0034762	0.334	regulation of transmembrane transport
GO:0048731	0.306	system development
GO:0010959	0.300	regulation of metal ion transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.998	membrane-bounded organelle
GO:0043229	0.998	intracellular organelle
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0031981	0.987	nuclear lumen
GO:0005654	0.980	nucleoplasm
GO:0032991	0.964	protein-containing complex
GO:0005730	0.816	nucleolus
GO:0005737	0.670	cytoplasm
GO:0098797	0.563	plasma membrane protein complex
GO:0034703	0.557	cation channel complex
GO:0034706	0.368	sodium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]