StarFunc result for job id Q14525

User Input

>input (404 residues)
MPYNFCLPSLSCRTSCSSRPCVPPSCHGYTLPGACNIPANVSNCNWFCEGSFNGSEKETM
QFLNDRLASYLEKVRQLERDNAELENLIRERSQQQEPLLCPSYQSYFKTIEELQQKILCS
KSENARLVVQIDNAKLAADDFRTKYQTEQSLRQLVESDINSLRRILDELTLCRSDLEAQM
ESLKEELLSLKQNHEQEVNTLRCQLGDRLNVEVDAAPAVDLNQVLNETRNQYEALVETNR
REVEQWFATQTEELNKQVVSSSEQLQSYQAEIIELRRTVNALEIELQAQHNLRYSLENTL
TESEARYSSQLSQVQSLITNVESQLAEIRSDLERQNQEYQVLLDVRARLECEINTYRSLL
ESEDCKLPSNPCATTNACEKPIGSCVTNPCGPRSRCGPCNTFGY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15323	0.724	0.705	1.175E-42	416	0.941	0.913	Q15323.pdb.gz	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
2	AFDB:O76011	0.833	0.776	1.907E-41	436	0.874	0.810	O76011.pdb.gz	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
3	AFDB:Q14532	0.711	0.651	2.605E-31	448	0.671	0.605	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
4	AFDB:O76013	0.651	0.575	2.098E-29	467	0.693	0.600	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
5	AFDB:Q92764	0.598	0.541	2.403E-28	455	0.698	0.620	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
6	AFDB:O76015	0.748	0.671	5.504E-26	456	0.621	0.550	O76015.pdb.gz	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
7	AFDB:Q6A162	0.689	0.650	7.273E-26	431	0.601	0.564	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
8	AFDB:Q6IFW3	0.606	0.520	6.281E-24	481	0.567	0.476	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
9	AFDB:Q6A163	0.485	0.412	1.097E-23	491	0.584	0.481	Q6A163.pdb.gz	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
10	AFDB:P02533	0.652	0.567	1.537E-20	472	0.498	0.426	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AQ75	0.0	518	473	0.671	0.573	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
2	O76009	0.0	758	404	0.938	0.938	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
3	O76011	0.0	693	436	0.874	0.810	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
4	O76013	0.0	532	467	0.688	0.595	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
5	Q14525	0.0	816	404	1.000	1.000	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
6	Q14532	0.0	528	448	0.666	0.600	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
7	Q15323	0.0	751	416	0.938	0.911	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
8	Q92764	0.0	519	455	0.663	0.589	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
9	O76015	6.10e-173	493	456	0.616	0.546	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
10	O76014	1.91e-162	466	449	0.589	0.530	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
11	Q6A162	3.54e-158	454	431	0.604	0.566	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
12	Q6A163	1.15e-144	422	491	0.567	0.466	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
13	Q6IFW3	2.42e-143	418	481	0.559	0.470	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
14	Q6IFU8	2.97e-130	383	433	0.488	0.455	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
15	Q9QWL7	4.07e-130	383	433	0.488	0.455	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
16	Q6PVZ1	1.54e-129	382	467	0.473	0.409	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
17	Q04695	8.55e-129	379	432	0.473	0.442	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
18	P02533	1.05e-127	378	472	0.470	0.403	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
19	P08727	1.71e-127	375	400	0.441	0.445	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
20	Q6IFV1	3.01e-127	377	485	0.468	0.390	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16888 DUF5082	71	15.1	Domain of unknown function (DUF5082)
2	PF00038 Filament	4e-101	350.3	Intermediate filament protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251646

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301656	0.630	Keratin, type I cytoskeletal 27
2	9606.ENSP00000310573	0.566	Keratin, type I cytoskeletal 25
3	9606.ENSP00000305263	0.561	Keratin, type I cytoskeletal 28
4	9606.ENSP00000246662	0.554	Keratin, type I cytoskeletal 9
5	9606.ENSP00000301653	0.544	Keratin, type I cytoskeletal 16
6	9606.ENSP00000308452	0.544	Keratin, type I cytoskeletal 17
7	9606.ENSP00000269576	0.542	Keratin, type I cytoskeletal 10
8	9606.ENSP00000448220	0.541	Keratin, type II cytoskeletal 4
9	9606.ENSP00000377570	0.540	Keratin, type I cuticular Ha4
10	9606.ENSP00000167586	0.536	Keratin, type I cytoskeletal 14
11	9606.ENSP00000254043	0.536	Keratin, type I cytoskeletal 15
12	9606.ENSP00000251643	0.534	Keratin, type I cytoskeletal 12
13	9606.ENSP00000167588	0.533	Keratin, type I cytoskeletal 20
14	9606.ENSP00000246635	0.533	Keratin, type I cytoskeletal 13
15	9606.ENSP00000264651	0.533	Keratin, type I cytoskeletal 24
16	9606.ENSP00000355124	0.533	Keratin, type I cytoskeletal 19
17	9606.ENSP00000375429	0.531	Keratin-associated protein 3-2
18	9606.ENSP00000209718	0.513	Keratin, type I cytoskeletal 23
19	9606.ENSP00000334798	0.513	Keratin, type I cytoskeletal 26
20	9606.ENSP00000373487	0.507	Keratin, type I cytoskeletal 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.990	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048856	0.995	anatomical structure development
GO:0008544	0.866	epidermis development
GO:0009987	0.461	cellular process
GO:0032501	0.381	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005615	0.998	extracellular space
GO:0043227	0.996	membrane-bounded organelle
GO:1903561	0.993	extracellular vesicle
GO:0043232	0.964	intracellular non-membrane-bounded organelle
GO:0005856	0.946	cytoskeleton
GO:0045111	0.941	intermediate filament cytoskeleton
GO:0005882	0.926	intermediate filament
GO:0070062	0.900	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]