StarFunc result for job id Q14526

User Input

>input (733 residues)
MTFPEADILLKSGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRA
HKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAAVAP
GAEPSLGAVLAAASYLQIPDLVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRA
ATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLC
GLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEA
APPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERG
GDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYP
CPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAA
GLGPPFGGGGDKVAGAPGGLGELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTIC
GKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKF
AQQRNLISHMKMHAVGGAAGAAGALAGLGGLPGVPGPDGKGKLDFPEGVFAVARLTAEQL
SLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAA
GPDGRTIDRFSPT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14526	1.000	1.000	5.208E-94	733	1.000	1.000	Q14526.pdb.gz	HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo sapiens OX=9606 GN=HIC1 PE=1 SV=5
2	AFDB:Q70ZY9	0.160	0.159	1.890E-36	737	0.484	0.482	Q70ZY9.pdb.gz	Q70ZY9_DANRE HIC1 protein OS=Danio rerio OX=7955 GN=zfHIC1 PE=2 SV=1
3	AFDB:Q96JB3	0.215	0.249	1.097E-33	615	0.400	0.476	Q96JB3.pdb.gz	HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens OX=9606 GN=HIC2 PE=1 SV=2
4	AFDB:F1RAC1	0.137	0.090	6.665E-12	1146	0.188	0.120	F1RAC1.pdb.gz	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
5	AFDB:Q923B3	0.147	0.130	1.493E-9	828	0.160	0.141	Q923B3.pdb.gz	NRIF1_MOUSE Neurotrophin receptor-interacting factor 1 OS=Mus musculus OX=10090 GN=Nrif1 PE=1 SV=3
6	AFDB:A0A024R4Z1	0.121	0.151	4.077E-8	570	0.149	0.191	A0A024R4Z1.pdb.gz
7	AFDB:Q96T25	0.151	0.166	1.111E-7	663	0.169	0.187	Q96T25.pdb.gz	ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens OX=9606 GN=ZIC5 PE=1 SV=2
8	AFDB:Q9Y462	0.089	0.087	1.111E-7	761	0.115	0.110	Q9Y462.pdb.gz	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
9	AFDB:Q8I7Z8	0.118	0.088	2.737E-7	990	0.143	0.106	Q8I7Z8.pdb.gz	HAM_DROME Transcription factor hamlet OS=Drosophila melanogaster OX=7227 GN=ham PE=2 SV=1
10	AFDB:A2A935	0.127	0.077	5.251E-7	1275	0.164	0.094	A2A935.pdb.gz	PRD16_MOUSE Histone-lysine N-methyltransferase PRDM16 OS=Mus musculus OX=10090 GN=Prdm16 PE=1 SV=1
11	PDB:3w5kB	0.074	0.296	2.003E-3	110	0.048	0.318	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6h02A	0.084	0.051	1.052	1334	0.030	0.016	6h02A.pdb.gz
13	PDB:6wcqC	0.067	0.360	1.420	130	0.019	0.108	6wcqC.pdb.gz
14	PDB:5a1vK	0.061	0.043	1.736	1126	0.022	0.014	5a1vK.pdb.gz
15	PDB:7pubFh	0.088	0.203	1.825	274	0.026	0.069	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
16	PDB:6w1sR	0.088	0.053	2.017	1295	0.030	0.017	6w1sR.pdb.gz	A Pliable Mediator Acts as a Functional Rather Than an Architectural Bridge between Promoters and Enhancers.
17	PDB:6gypD	0.074	0.317	2.121	151	0.025	0.119	6gypD.pdb.gz	Architecture of the CBF3-centromere complex of the budding yeast kinetochore.
18	PDB:3javA	0.057	0.028	2.465	2327	0.093	0.029	3javA.pdb.gz
19	PDB:5vztA	0.070	0.318	3.012	145	0.019	0.097	5vztA.pdb.gz	Structural basis of the phosphorylation-independent recognition of cyclin D1 by the SCFFBXO31 ubiquitin ligase.
20	PDB:3ogkA	0.084	0.353	3.167	145	0.023	0.117	3ogkA.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14526	0.0	1459	733	1.000	1.000	HIC1_HUMAN Hypermethylated in cancer 1 protein OS=Homo sapiens OX=9606 GN=HIC1 PE=1 SV=5
2	Q70ZY9	0.0	582	737	0.535	0.532	Q70ZY9_DANRE HIC1 protein OS=Danio rerio OX=7955 GN=zfHIC1 PE=2 SV=1
3	Q9R1Y5	0.0	1097	733	0.955	0.955	HIC1_MOUSE Hypermethylated in cancer 1 protein OS=Mus musculus OX=10090 GN=Hic1 PE=1 SV=4
4	Q96JB3	8.48e-138	421	615	0.405	0.483	HIC2_HUMAN Hypermethylated in cancer 2 protein OS=Homo sapiens OX=9606 GN=HIC2 PE=1 SV=2
5	Q15937	1.51e-30	128	498	0.089	0.131	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
6	P52736	1.55e-30	130	654	0.090	0.101	ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens OX=9606 GN=ZNF133 PE=1 SV=2
7	Q9UC06	1.55e-30	127	446	0.093	0.152	ZNF70_HUMAN Zinc finger protein 70 OS=Homo sapiens OX=9606 GN=ZNF70 PE=2 SV=2
8	Q9UJW8	4.09e-30	129	692	0.089	0.094	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
9	Q6NX49	6.21e-30	128	715	0.093	0.095	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
10	P17036	8.35e-30	125	446	0.087	0.143	ZNF3_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=3
11	Q86U76	1.19e-29	124	410	0.087	0.156	Q86U76_HUMAN Zinc finger protein 3 OS=Homo sapiens OX=9606 GN=ZNF3 PE=1 SV=1
12	P10073	1.23e-29	125	491	0.091	0.136	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
13	Q96MU6	1.27e-29	127	729	0.094	0.095	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
14	P21506	2.63e-29	125	573	0.094	0.120	ZNF10_HUMAN Zinc finger protein 10 OS=Homo sapiens OX=9606 GN=ZNF10 PE=1 SV=3
15	P13360	3.26e-29	125	604	0.068	0.083	GLAS_DROME Protein glass OS=Drosophila melanogaster OX=7227 GN=gl PE=1 SV=2
16	P28698	3.28e-29	126	734	0.090	0.090	MZF1_HUMAN Myeloid zinc finger 1 OS=Homo sapiens OX=9606 GN=MZF1 PE=1 SV=3
17	Q9UEG4	4.82e-29	126	869	0.095	0.081	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
18	P17026	6.91e-29	117	224	0.065	0.214	ZNF22_HUMAN Zinc finger protein 22 OS=Homo sapiens OX=9606 GN=ZNF22 PE=1 SV=3
19	A0JPL0	7.51e-29	124	549	0.090	0.120	ZN382_RAT Zinc finger protein 382 OS=Rattus norvegicus OX=10116 GN=Znf382 PE=1 SV=1
20	Q6ZN57	8.02e-29	122	461	0.087	0.139	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	2.7e-19	80.8	BTB/POZ domain
2	PF01428 zf-AN1	9.9e+02	11.3	AN1-like Zinc finger
3	PF00096 zf-C2H2	1.7e-18	77.0	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	0.0056	27.7	zinc-finger C2H2-type
5	PF12756 zf-C2H2_2	0.34	22.6	C2H2 type zinc-finger (2 copies)
6	PF18868 zf-C2H2_3rep	0.016	27.3	Zinc finger C2H2-type, 3 repeats
7	PF13894 zf-C2H2_4	7.3e-17	71.6	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	6.6e-08	43.6	C2H2-type zinc finger
9	PF16293 zf-C2H2_9	1.5e+02	13.6	C2H2 type zinc-finger (1 copy)
10	PF12171 zf-C2H2_jaz	4.9e-11	53.8	Zinc-finger double-stranded RNA-binding
11	PF05605 zf-Di19	1.7	20.3	Drought induced 19 protein (Di19), zinc-binding
12	PF13465 zf-H2C2_2	3.2e-16	70.1	Zinc-finger double domain
13	PF12874 zf-met	5.9e-06	37.7	Zinc-finger of C2H2 type
14	PF02148 zf-UBP	1.3e+02	14.4	Zn-finger in ubiquitin-hydrolases and other protein
15	PF18439 zf_UBZ	1.8e+02	13.2	Ubiquitin-Binding Zinc Finger
16	PF09723 Zn-ribbon_8	4.2e+02	12.5	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314080

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290921	0.994	C-terminal-binding protein 1
2	9606.ENSP00000212015	0.993	NAD-dependent protein deacetylase sirtuin-1
3	9606.ENSP00000269305	0.974	Cellular tumor antigen p53
4	9606.ENSP00000333633	0.968	Metastasis-associated protein MTA1
5	9606.ENSP00000348056	0.957	SUMO-conjugating enzyme UBC9
6	9606.ENSP00000465676	0.954	E3 SUMO-protein ligase PIAS2
7	9606.ENSP00000249636	0.931	E3 SUMO-protein ligase PIAS1
8	9606.ENSP00000320485	0.926	AT-rich interactive domain-containing protein 1A
9	9606.ENSP00000312988	0.904	NF-kappa-B inhibitor beta
10	9606.ENSP00000311825	0.849	C-terminal-binding protein 2
11	9606.ENSP00000376077	0.835	Small ubiquitin-related modifier 1
12	9606.ENSP00000264657	0.823	Signal transducer and activator of transcription 3
13	9606.ENSP00000320147	0.738	Histone-lysine N-methyltransferase EZH2
14	9606.ENSP00000349547	0.714	Ras association domain-containing protein 1
15	9606.ENSP00000264335	0.664	14-3-3 protein epsilon
16	9606.ENSP00000330862	0.664	Opioid-binding protein/cell adhesion molecule
17	9606.ENSP00000352516	0.664	DNA (cytosine-5)-methyltransferase 1
18	9606.ENSP00000302111	0.640	Methylated-DNA--protein-cysteine methyltransferase
19	9606.ENSP00000316809	0.639	Phosphatidylinositol transfer protein alpha isoform
20	9606.ENSP00000369611	0.638	Spermatogenic leucine zipper protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1990837	0.996	sequence-specific double-stranded DNA binding
GO:0019899	0.987	enzyme binding
GO:0001217	0.986	DNA-binding transcription repressor activity
GO:0001227	0.979	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0042826	0.895	histone deacetylase binding
GO:0000976	0.569	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0080090	0.994	regulation of primary metabolic process
GO:0010468	0.993	regulation of gene expression
GO:0009987	0.983	cellular process
GO:0051171	0.981	regulation of nitrogen compound metabolic process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0048519	0.968	negative regulation of biological process
GO:0006355	0.965	regulation of DNA-templated transcription
GO:0048523	0.960	negative regulation of cellular process
GO:0050896	0.947	response to stimulus
GO:0009892	0.938	negative regulation of metabolic process
GO:0051172	0.916	negative regulation of nitrogen compound metabolic process
GO:0010605	0.916	negative regulation of macromolecule metabolic process
GO:0031324	0.913	negative regulation of cellular metabolic process
GO:0006357	0.905	regulation of transcription by RNA polymerase II
GO:0010558	0.900	negative regulation of macromolecule biosynthetic process
GO:0031327	0.898	negative regulation of cellular biosynthetic process
GO:0051253	0.898	negative regulation of RNA metabolic process
GO:0051716	0.891	cellular response to stimulus
GO:0045892	0.890	negative regulation of DNA-templated transcription
GO:0097193	0.831	intrinsic apoptotic signaling pathway
GO:0048583	0.798	regulation of response to stimulus
GO:0006974	0.770	cellular response to DNA damage stimulus
GO:0023051	0.761	regulation of signaling
GO:0010646	0.761	regulation of cell communication
GO:0048518	0.709	positive regulation of biological process
GO:0000122	0.639	negative regulation of transcription by RNA polymerase II
GO:0008630	0.577	intrinsic apoptotic signaling pathway in response to DNA damage
GO:0048522	0.576	positive regulation of cellular process
GO:0009966	0.540	regulation of signal transduction
GO:0009893	0.338	positive regulation of metabolic process
GO:0008152	0.336	metabolic process
GO:0010604	0.311	positive regulation of macromolecule metabolic process
GO:0071704	0.307	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0043232	0.990	intracellular non-membrane-bounded organelle
GO:0005694	0.922	chromosome
GO:0032991	0.905	protein-containing complex
GO:0005737	0.741	cytoplasm
GO:0000785	0.732	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]