StarFunc result for job id Q14532

User Input

>input (448 residues)
MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCLPTTFRPAS
CLSKTYLSSSCQAASGISGSMGPGSWYSEGAFNGNEKETMQFLNDRLASYLTRVRQLEQE
NAELESRIQEASHSQVLTMTPDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADD
FRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVGS
LRCQLGDRLNIEVDAAPPVDLTRVLEEMRCQYEAMVEANRRDVEEWFNMQMEELNQQVAT
SSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQLAQMQCMITN
VEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLENEDCKLPCNPCSTPSCTTC
VPSPCVPRTVCVPRTVGMPCSPCPQGRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14532	1.000	1.000	9.762E-62	448	1.000	1.000	Q14532.pdb.gz	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
2	AFDB:Q92764	0.634	0.625	2.520E-35	455	0.688	0.677	Q92764.pdb.gz	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
3	AFDB:O76013	0.660	0.636	3.129E-35	467	0.663	0.636	O76013.pdb.gz	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
4	AFDB:B1AQ75	0.481	0.459	1.527E-34	473	0.634	0.600	B1AQ75.pdb.gz	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
5	AFDB:O76011	0.679	0.695	1.331E-32	436	0.603	0.619	O76011.pdb.gz	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
6	AFDB:Q15323	0.649	0.693	6.494E-32	416	0.625	0.673	Q15323.pdb.gz	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
7	AFDB:Q6A162	0.518	0.535	6.536E-30	431	0.556	0.578	Q6A162.pdb.gz	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
8	AFDB:Q6A163	0.450	0.415	9.462E-27	491	0.571	0.521	Q6A163.pdb.gz	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
9	AFDB:O76015	0.644	0.634	4.963E-26	456	0.574	0.564	O76015.pdb.gz	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
10	AFDB:Q6IFW3	0.636	0.595	4.963E-26	481	0.545	0.507	Q6IFW3.pdb.gz	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AQ75	0.0	557	473	0.627	0.594	KRT36_MOUSE Keratin, type I cuticular Ha6 OS=Mus musculus OX=10090 GN=Krt36 PE=1 SV=1
2	O76009	0.0	530	404	0.605	0.671	KT33A_HUMAN Keratin, type I cuticular Ha3-I OS=Homo sapiens OX=9606 GN=KRT33A PE=2 SV=2
3	O76011	0.0	520	436	0.592	0.608	KRT34_HUMAN Keratin, type I cuticular Ha4 OS=Homo sapiens OX=9606 GN=KRT34 PE=1 SV=3
4	O76013	0.0	558	467	0.643	0.617	KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens OX=9606 GN=KRT36 PE=1 SV=1
5	Q14525	0.0	528	404	0.600	0.666	KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens OX=9606 GN=KRT33B PE=1 SV=3
6	Q14532	0.0	917	448	1.000	1.000	K1H2_HUMAN Keratin, type I cuticular Ha2 OS=Homo sapiens OX=9606 GN=KRT32 PE=1 SV=3
7	Q15323	0.0	537	416	0.609	0.656	K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens OX=9606 GN=KRT31 PE=1 SV=3
8	Q92764	0.0	556	455	0.665	0.655	KRT35_HUMAN Keratin, type I cuticular Ha5 OS=Homo sapiens OX=9606 GN=KRT35 PE=1 SV=5
9	Q6A162	6.50e-162	465	431	0.560	0.582	K1C40_HUMAN Keratin, type I cytoskeletal 40 OS=Homo sapiens OX=9606 GN=KRT40 PE=1 SV=2
10	O76015	4.85e-160	461	456	0.545	0.535	KRT38_HUMAN Keratin, type I cuticular Ha8 OS=Homo sapiens OX=9606 GN=KRT38 PE=1 SV=3
11	O76014	1.91e-157	454	449	0.542	0.541	KRT37_HUMAN Keratin, type I cuticular Ha7 OS=Homo sapiens OX=9606 GN=KRT37 PE=1 SV=3
12	Q6A163	5.09e-153	445	491	0.562	0.513	K1C39_HUMAN Keratin, type I cytoskeletal 39 OS=Homo sapiens OX=9606 GN=KRT39 PE=1 SV=2
13	Q6IFW3	6.93e-149	434	481	0.529	0.493	K1C39_RAT Keratin, type I cytoskeletal 39 OS=Rattus norvegicus OX=10116 GN=Krt39 PE=3 SV=1
14	P19001	1.38e-129	382	403	0.433	0.481	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
15	Q6IFU8	1.51e-127	378	433	0.442	0.457	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
16	Q9QWL7	1.61e-127	378	433	0.442	0.457	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
17	Q6PVZ1	1.22e-126	377	467	0.415	0.398	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
18	P08727	8.34e-126	372	400	0.402	0.450	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4
19	Q04695	8.58e-125	371	432	0.424	0.440	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
20	P02533	1.67e-124	372	472	0.420	0.398	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04513 Baculo_PEP_C	2.8e+02	13.0	Baculovirus polyhedron envelope protein, PEP, C terminus
2	PF04977 DivIC	6.7e+02	11.5	Septum formation initiator
3	PF00038 Filament	8.9e-101	349.2	Intermediate filament protein
4	PF07195 FliD_C	5e+02	11.5	Flagellar hook-associated protein 2 C-terminus
5	PF14389 Lzipper-MIP1	83	14.9	Leucine-zipper of ternary complex factor MIP1
6	PF06810 Phage_GP20	21	16.4	Phage minor structural protein GP20
7	PF02996 Prefoldin	4.3e+02	12.2	Prefoldin subunit
8	PF07926 TPR_MLP1_2	88	14.6	TPR/MLP1/MLP2-like protein
9	PF04871 Uso1_p115_C	7.9	18.2	Uso1 / p115 like vesicle tethering protein, C terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225899

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243103	0.693	Homeobox protein Hox-C12
2	9606.ENSP00000323555	0.681	Olfactory receptor 8K3
3	9606.ENSP00000243056	0.607	Homeobox protein Hox-C13
4	9606.ENSP00000321627	0.599	Ankyrin repeat and fibronectin type III domain containing 1
5	9606.ENSP00000440915	0.598	Mitochondrial ribonuclease P catalytic subunit
6	9606.ENSP00000226247	0.567	Forkhead box protein N1
7	9606.ENSP00000352785	0.536	Desmoglein-4
8	9606.ENSP00000254043	0.535	Keratin, type I cytoskeletal 15
9	9606.ENSP00000246662	0.533	Keratin, type I cytoskeletal 9
10	9606.ENSP00000305263	0.532	Keratin, type I cytoskeletal 28
11	9606.ENSP00000264651	0.529	Keratin, type I cytoskeletal 24
12	9606.ENSP00000301656	0.527	Keratin, type I cytoskeletal 27
13	9606.ENSP00000310573	0.527	Keratin, type I cytoskeletal 25
14	9606.ENSP00000301653	0.526	Keratin, type I cytoskeletal 16
15	9606.ENSP00000308452	0.524	Keratin, type I cytoskeletal 17
16	9606.ENSP00000167586	0.523	Keratin, type I cytoskeletal 14
17	9606.ENSP00000246635	0.518	Keratin, type I cytoskeletal 13
18	9606.ENSP00000355124	0.514	Keratin, type I cytoskeletal 19
19	9606.ENSP00000209718	0.513	Keratin, type I cytoskeletal 23
20	9606.ENSP00000251643	0.505	Keratin, type I cytoskeletal 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.606	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.996	developmental process
GO:0048856	0.986	anatomical structure development
GO:0008544	0.926	epidermis development
GO:0009987	0.493	cellular process
GO:0065007	0.342	biological regulation
GO:0050794	0.329	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.997	membrane-bounded organelle
GO:0005615	0.996	extracellular space
GO:0031982	0.986	vesicle
GO:0070062	0.983	extracellular exosome
GO:0043229	0.920	intracellular organelle
GO:0043228	0.867	non-membrane-bounded organelle
GO:0043232	0.811	intracellular non-membrane-bounded organelle
GO:0045111	0.575	intermediate filament cytoskeleton
GO:0005882	0.466	intermediate filament

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]