StarFunc result for job id Q14533

User Input

>input (505 residues)
MTCGSGFGGRAFSCISACGPRPGRCCITAAPYRGISCYRGLTGGFGSHSVCGGFRAGSCG
RSFGYRSGGVCGPSPPCITTVSVNESLLTPLNLEIDPNAQCVKQEEKEQIKSLNSRFAAF
IDKVRFLEQQNKLLETKLQFYQNRECCQSNLEPLFEGYIETLRREAECVEADSGRLASEL
NHVQEVLEGYKKKYEEEVSLRATAENEFVALKKDVDCAYLRKSDLEANVEALIQEIDFLR
RLYEEEILILQSHISDTSVVVKLDNSRDLNMDCIIAEIKAQYDDIVTRSRAEAESWYRSK
CEEMKATVIRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAA
LSDARCKLAELEGALQKAKQDMACLIREYQEVMNSKLGLDIEIATYRRLLEGEEQRLCEG
IGAVNVCVSSSRGGVVCGDLCVSGSRPVTGSVCSAPCNGNVAVSTGLCAPCGQLNTTCGG
GSCGVGSCGISSLGVGSCGSSCRKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14533	1.000	1.000	1.296E-63	505	1.000	1.000	Q14533.pdb.gz	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
2	AFDB:Q6IG08	0.346	0.318	5.319E-45	555	0.778	0.708	Q6IG08.pdb.gz	Q6IG08_RAT Type II keratin Kb23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
3	AFDB:P78386	0.351	0.350	7.155E-45	507	0.794	0.791	P78386.pdb.gz	KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens OX=9606 GN=KRT85 PE=1 SV=1
4	AFDB:Q9NSB2	0.308	0.262	3.756E-32	600	0.602	0.507	Q9NSB2.pdb.gz	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
5	AFDB:Q99M73	0.297	0.253	1.230E-31	603	0.610	0.511	Q99M73.pdb.gz	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
6	AFDB:Q9NSB4	0.400	0.394	2.226E-31	513	0.582	0.573	Q9NSB4.pdb.gz	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
7	AFDB:A0A1D5PXP0	0.358	0.348	2.936E-26	522	0.483	0.467	A0A1D5PXP0.pdb.gz
8	AFDB:P13647	0.588	0.512	4.254E-26	590	0.485	0.415	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
9	AFDB:Q922U2	0.387	0.346	9.617E-26	580	0.499	0.434	Q922U2.pdb.gz	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
10	AFDB:P02538	0.566	0.512	1.616E-25	564	0.493	0.441	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
11	PDB:5lj5O	0.099	0.150	2.699	283	0.059	0.106	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:6exnO	0.088	0.128	4.212	320	0.055	0.087	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
13	PDB:6ft6u	0.080	0.218	7.077	150	0.028	0.093	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KA07	0.0	763	543	0.731	0.680	A0A0G2KA07_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
2	A0A8I5ZLV7	0.0	841	487	0.814	0.844	A0A8I5ZLV7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
3	A0A8I6AFC7	0.0	846	488	0.820	0.848	A0A8I6AFC7_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
4	A0A8I6G2U8	0.0	779	447	0.743	0.839	A0A8I6G2U8_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=3 SV=1
5	A7M776	0.0	875	479	0.846	0.891	A7M776_RAT Type II keratin 23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
6	O43790	0.0	905	486	0.905	0.940	KRT86_HUMAN Keratin, type II cuticular Hb6 OS=Homo sapiens OX=9606 GN=KRT86 PE=1 SV=1
7	P78385	0.0	942	493	0.927	0.949	KRT83_HUMAN Keratin, type II cuticular Hb3 OS=Homo sapiens OX=9606 GN=KRT83 PE=1 SV=2
8	P78386	0.0	787	507	0.790	0.787	KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens OX=9606 GN=KRT85 PE=1 SV=1
9	Q14533	0.0	1019	505	1.000	1.000	KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens OX=9606 GN=KRT81 PE=1 SV=3
10	Q6IG08	0.0	783	555	0.750	0.683	Q6IG08_RAT Type II keratin Kb23 OS=Rattus norvegicus OX=10116 GN=Krt83 PE=2 SV=1
11	Q99M73	0.0	558	603	0.552	0.463	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
12	Q9NSB2	0.0	548	600	0.590	0.497	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
13	Q9NSB4	0.0	529	513	0.570	0.561	KRT82_HUMAN Keratin, type II cuticular Hb2 OS=Homo sapiens OX=9606 GN=KRT82 PE=1 SV=3
14	A6NCN2	1.35e-154	442	255	0.432	0.855	KR87P_HUMAN Putative keratin-87 protein OS=Homo sapiens OX=9606 GN=KRT87P PE=5 SV=4
15	Q6P6Q2	7.89e-151	444	576	0.430	0.377	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
16	P13647	1.02e-150	445	590	0.422	0.361	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
17	Q922U2	2.95e-150	443	580	0.424	0.369	K2C5_MOUSE Keratin, type II cytoskeletal 5 OS=Mus musculus OX=10090 GN=Krt5 PE=1 SV=1
18	Q8BGZ7	5.36e-150	442	551	0.469	0.430	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
19	O95678	2.03e-149	440	551	0.463	0.425	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
20	P50446	5.76e-149	439	553	0.422	0.385	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15915 BAT	2.4e+02	13.0	GAF and HTH_10 associated domain
2	PF07888 CALCOCO1	3.4	18.1	Calcium binding and coiled-coil domain (CALCOCO1) like
3	PF20270 CATRA-C	5e+02	12.7	CASPASE and TPR Repeat-Associated C-terminal domain
4	PF10473 CENP-F_leu_zip	8.1e+02	11.4	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
5	PF16271 DUF4924	7.4	18.0	Domain of unknown function (DUF4924)
6	PF05960 DUF885	27	15.9	Bacterial protein of unknown function (DUF885)
7	PF00038 Filament	2.4e-94	328.1	Intermediate filament protein
8	PF04399 Glutaredoxin2_C	4.9e+02	11.9	Glutaredoxin 2, C terminal domain
9	PF16208 Keratin_2_head	1.3e-09	49.9	Keratin type II head
10	PF18595 Nuf2_DHR10-like	12	17.4	Nuf2, DHR10-like domain
11	PF18052 Rx_N	9.6e+02	11.5	Rx N-terminal domain
12	PF11544 Spc42p	9e+02	11.2	Spindle pole body component Spc42p
13	PF07926 TPR_MLP1_2	0.0012	30.3	TPR/MLP1/MLP2-like protein
14	PF12718 Tropomyosin_1	67	15.1	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369349

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378292	0.643	Keratin, type II cytoskeletal 80
2	9606.ENSP00000444533	0.623	Keratin, type II cuticular Hb6
3	9606.ENSP00000355045	0.610	TOG array regulator of axonemal microtubules protein 1
4	9606.ENSP00000329243	0.595	Keratin, type II cytoskeletal 7
5	9606.ENSP00000352785	0.572	Desmoglein-4
6	9606.ENSP00000369317	0.538	Keratin, type II cytoskeletal 6A
7	9606.ENSP00000449404	0.537	Keratin, type II cytoskeletal 8
8	9606.ENSP00000310861	0.532	Keratin, type II cytoskeletal 2 epidermal
9	9606.ENSP00000252252	0.527	Keratin, type II cytoskeletal 6B
10	9606.ENSP00000252242	0.525	Keratin, type II cytoskeletal 5
11	9606.ENSP00000252245	0.523	Keratin, type II cytoskeletal 75
12	9606.ENSP00000448220	0.523	Keratin, type II cytoskeletal 4
13	9606.ENSP00000252250	0.522	Keratin, type II cytoskeletal 6C
14	9606.ENSP00000267119	0.520	Keratin, type II cytoskeletal 71
15	9606.ENSP00000306261	0.520	Keratin, type II cytoskeletal 78
16	9606.ENSP00000342710	0.519	Keratin, type II cytoskeletal 1b
17	9606.ENSP00000261556	0.518	Transmembrane protein 260
18	9606.ENSP00000293745	0.518	Keratin, type II cytoskeletal 72
19	9606.ENSP00000307014	0.518	Keratin, type II cytoskeletal 73
20	9606.ENSP00000307240	0.516	Keratin, type II cytoskeletal 74

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.915	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0048856	0.987	anatomical structure development
GO:0008544	0.848	epidermis development
GO:0032501	0.527	multicellular organismal process
GO:0045103	0.399	intermediate filament-based process
GO:0065007	0.378	biological regulation
GO:0050794	0.328	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005615	0.997	extracellular space
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0045095	0.991	keratin filament
GO:0043227	0.810	membrane-bounded organelle
GO:0070062	0.635	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]