StarFunc result for job id Q14541

User Input

>input (408 residues)
MNTTDNGVNCLCAICGDRATGKHYGASSCDGCKGFFRRSIRKSHVYSCRFSRQCVVDKDK
RNQCRYCRLRKCFRAGMKKEAVQNERDRISTRRSTFDGSNIPSINTLAQAEVRSRQISVS
SPGSSTDINVKKIASIGDVCESMKQQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHL
LLGATKRSMMYKDILLLGNNYVIHRNSCEVEISRVANRVLDELVRPFQEIQIDDNEYACL
KAIVFFDPDAKGLSDPVKIKNMRFQVQIGLEDYINDRQYDSRGRFGELLLLLPTLQSITW
QMIEQIQFVKLFGMVKIDNLLQEMLLGGASNDGSHLHHPMHPHLSQDPLTGQTILLGPMS
TLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A6E1WB48	0.838	0.753	3.245E-58	455	1.000	0.897	A0A6E1WB48.pdb.gz	A0A6E1WB48_HUMAN Hepatocyte nuclear factor 4 gamma OS=Homo sapiens OX=9606 GN=HNF4G PE=1 SV=1
2	AFDB:Q6PHH5	0.799	0.705	1.459E-48	463	0.752	0.663	Q6PHH5.pdb.gz
3	AFDB:F1NZ15	0.799	0.701	2.255E-47	466	0.743	0.650	F1NZ15.pdb.gz	F1NZ15_CHICK Hepatocyte nuclear factor 4 alpha OS=Gallus gallus OX=9031 GN=HNF4A PE=3 SV=2
4	AFDB:F1D8T1	0.794	0.686	1.658E-46	474	0.738	0.635	F1D8T1.pdb.gz	F1D8T1_HUMAN Hepatocyte nuclear factor 4 4 alpha variant 2 OS=Homo sapiens OX=9606 GN=NR2A1 PE=2 SV=1
5	AFDB:P49866	0.733	0.434	2.949E-37	704	0.586	0.339	P49866.pdb.gz	HNF4_DROME Transcription factor HNF-4 homolog OS=Drosophila melanogaster OX=7227 GN=Hnf4 PE=1 SV=3
6	AFDB:P91829	0.661	0.716	6.729E-27	373	0.326	0.357	P91829.pdb.gz	NHR69_CAEEL Nuclear hormone receptor family member nhr-69 OS=Caenorhabditis elegans OX=6239 GN=nhr-69 PE=1 SV=2
7	AFDB:A0A0S2Z570	0.525	0.403	2.185E-25	537	0.350	0.266	A0A0S2Z570.pdb.gz	A0A0S2Z570_HUMAN RXRB (Fragment) OS=Homo sapiens OX=9606 GN=RXRB PE=2 SV=1
8	AFDB:P51129	0.515	0.449	3.376E-24	470	0.346	0.300	P51129.pdb.gz	RXRG_XENLA Retinoic acid receptor RXR-gamma OS=Xenopus laevis OX=8355 GN=rxrg PE=2 SV=1
9	AFDB:A0A1D5PVE2	0.525	0.461	3.880E-24	467	0.333	0.291	A0A1D5PVE2.pdb.gz
10	AFDB:A0A1D5P2B5	0.501	0.440	4.671E-24	467	0.348	0.304	A0A1D5P2B5.pdb.gz	A0A1D5P2B5_CHICK Retinoic acid receptor RXR OS=Gallus gallus OX=9031 GN=RXRA PE=1 SV=2
11	PDB:3dzyA	0.486	0.650	8.076E-23	302	0.333	0.450	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:1g2nA	0.440	0.715	2.095E-10	246	0.154	0.256	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
13	PDB:6fx0A	0.472	0.775	1.943E-9	238	0.110	0.189	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
14	PDB:7kw7F	0.420	0.640	1.069E-6	259	0.118	0.185	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:6ikoA	0.098	0.127	2.037E-1	303	0.083	0.112	6ikoA.pdb.gz
16	PDB:4nq0A	0.136	0.193	4.697E-1	254	0.056	0.091	4nq0A.pdb.gz
17	PDB:3hf1B	0.101	0.129	5.398E-1	286	0.078	0.112	3hf1B.pdb.gz	2.6 A X-ray crystal structure of human p53R2, a p53-inducible ribonucleotide reductase .
18	PDB:1yo7A	0.090	0.245	5.923E-1	120	0.032	0.108	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
19	PDB:2rsvA	0.097	0.098	7.131E-1	403	0.091	0.092	2rsvA.pdb.gz
20	PDB:3hajA	0.125	0.166	7.131E-1	286	0.091	0.129	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WXV4	0.0	551	377	0.654	0.708	A0A087WXV4_HUMAN Hepatocyte nuclear factor 4 alpha (Fragment) OS=Homo sapiens OX=9606 GN=HNF4A PE=1 SV=2
2	A0A6E1WB48	0.0	855	455	1.000	0.897	A0A6E1WB48_HUMAN Hepatocyte nuclear factor 4 gamma OS=Homo sapiens OX=9606 GN=HNF4G PE=1 SV=1
3	A8E5K2	0.0	639	427	0.743	0.710	A8E5K2_DANRE Hepatocyte nuclear factor 4-alpha isoform X5 OS=Danio rerio OX=7955 GN=wu:fb58h09 PE=2 SV=1
4	F1D8Q4	0.0	854	445	1.000	0.917	F1D8Q4_HUMAN Hepatocyte nuclear factor 4 gamma OS=Homo sapiens OX=9606 GN=NR2A2 PE=2 SV=1
5	F1D8S2	0.0	596	464	0.733	0.644	F1D8S2_HUMAN Hepatocyte nuclear factor 4 4 alpha variant 1 OS=Homo sapiens OX=9606 GN=NR2A1 PE=2 SV=1
6	F1D8T0	0.0	585	452	0.730	0.659	F1D8T0_HUMAN Hepatocyte nuclear factor 4 4 alpha variant 4 OS=Homo sapiens OX=9606 GN=NR2A1 PE=2 SV=1
7	F1D8T1	0.0	586	474	0.730	0.629	F1D8T1_HUMAN Hepatocyte nuclear factor 4 4 alpha variant 2 OS=Homo sapiens OX=9606 GN=NR2A1 PE=2 SV=1
8	F1NZ15	0.0	602	466	0.743	0.650	F1NZ15_CHICK Hepatocyte nuclear factor 4 alpha OS=Gallus gallus OX=9031 GN=HNF4A PE=3 SV=2
9	P22449	0.0	559	474	0.725	0.624	HNF4A_RAT Hepatocyte nuclear factor 4-alpha OS=Rattus norvegicus OX=10116 GN=Hnf4a PE=1 SV=3
10	P41235	0.0	586	474	0.730	0.629	HNF4A_HUMAN Hepatocyte nuclear factor 4-alpha OS=Homo sapiens OX=9606 GN=HNF4A PE=1 SV=3
11	P49698	0.0	560	474	0.725	0.624	HNF4A_MOUSE Hepatocyte nuclear factor 4-alpha OS=Mus musculus OX=10090 GN=Hnf4a PE=1 SV=2
12	Q14541	0.0	850	408	1.000	1.000	HNF4G_HUMAN Hepatocyte nuclear factor 4-gamma OS=Homo sapiens OX=9606 GN=HNF4G PE=1 SV=3
13	Q5ILH0	0.0	598	454	0.735	0.661	Q5ILH0_CHICK Hepatic nuclear factor 4alpha OS=Gallus gallus OX=9031 GN=HNF4alpha PE=2 SV=1
14	Q8AXB6	0.0	640	454	0.743	0.667	Q8AXB6_DANRE Hepatocyte nuclear factor 4-alpha OS=Danio rerio OX=7955 GN=id:ibd1279 PE=2 SV=1
15	Q9WUU6	0.0	780	408	0.958	0.958	HNF4G_MOUSE Hepatocyte nuclear factor 4-gamma OS=Mus musculus OX=10090 GN=Hnf4g PE=2 SV=2
16	P49866	6.36e-157	461	704	0.549	0.318	HNF4_DROME Transcription factor HNF-4 homolog OS=Drosophila melanogaster OX=7227 GN=Hnf4 PE=1 SV=3
17	A0A1D5P2B5	3.31e-88	277	467	0.346	0.302	A0A1D5P2B5_CHICK Retinoic acid receptor RXR OS=Gallus gallus OX=9031 GN=RXRA PE=1 SV=2
18	Q90415	7.87e-88	273	379	0.346	0.372	RXRAB_DANRE Retinoic acid receptor RXR-alpha-B OS=Danio rerio OX=7955 GN=rxrab PE=2 SV=1
19	Q05343	8.26e-88	276	467	0.338	0.296	RXRA_RAT Retinoic acid receptor RXR-alpha OS=Rattus norvegicus OX=10116 GN=Rxra PE=1 SV=1
20	P28700	1.05e-87	275	467	0.338	0.296	RXRA_MOUSE Retinoic acid receptor RXR-alpha OS=Mus musculus OX=10090 GN=Rxra PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	7.6e-36	135.2	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	1.6e-25	100.6	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000008296

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000009586	0.825	PPARG coactivator 1 alpha
2	9593.ENSGGOP00000013332	0.794	Mothers against decapentaplegic homolog
3	9593.ENSGGOP00000014934	0.748	Nuclear receptor subfamily 0, group B, member 2
4	9593.ENSGGOP00000007955	0.739	Nuclear receptor subfamily 1, group H, member 4
5	9593.ENSGGOP00000004612	0.734	Mothers against decapentaplegic homolog
6	9593.ENSGGOP00000004248	0.733	HNF1 homeobox A
7	9593.ENSGGOP00000009446	0.694	APOBEC1 complementation factor
8	9593.ENSGGOP00000021420	0.680	Mediator complex subunit 15
9	9593.ENSGGOP00000008032	0.677	E1A binding protein p300
10	9593.ENSGGOP00000021003	0.672	UDP-glucuronosyltransferase
11	9593.ENSGGOP00000011007	0.668	Nuclear receptor coactivator 1
12	9593.ENSGGOP00000020316	0.665	Apolipoprotein B
13	9593.ENSGGOP00000001814	0.643	Catenin beta 1
14	9593.ENSGGOP00000009200	0.639	Nuclear receptor corepressor 2
15	9593.ENSGGOP00000006588	0.635	Sulfotransferase family, cytosolic, 1C, member 2
16	9593.ENSGGOP00000024216	0.630	HNF1 homeobox B
17	9593.ENSGGOP00000003896	0.626	Forkhead box A3
18	9593.ENSGGOP00000005752	0.626	Solute carrier family 51, alpha subunit
19	9593.ENSGGOP00000023665	0.621	Mediator of RNA polymerase II transcription subunit 1
20	9593.ENSGGOP00000016059	0.606	Coagulation factor XIII, B polypeptide

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0097159	0.999	organic cyclic compound binding
GO:0005515	0.989	protein binding
GO:0003676	0.977	nucleic acid binding
GO:1990837	0.971	sequence-specific double-stranded DNA binding
GO:0000976	0.922	transcription cis-regulatory region binding
GO:0000981	0.895	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0038023	0.588	signaling receptor activity
GO:0098531	0.340	ligand-activated transcription factor activity
GO:0004879	0.312	nuclear receptor activity
GO:0000977	0.306	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0080090	0.996	regulation of primary metabolic process
GO:0048518	0.995	positive regulation of biological process
GO:0045893	0.990	positive regulation of DNA-templated transcription
GO:0045944	0.817	positive regulation of transcription by RNA polymerase II
GO:0009987	0.640	cellular process
GO:0050896	0.348	response to stimulus
GO:0008152	0.319	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.991	cytoplasm
GO:0005829	0.972	cytosol
GO:0043232	0.909	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]