StarFunc result for job id Q14558

User Input

>input (356 residues)
MNAARTGYRVFSANSTAACTELAKRITERLGAELGKSVVYQETNGETRVEIKESVRGQDI
FIIQTIPRDVNTAVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLAS
MLAKAGLTHIITMDLHQKEIQGFFSFPVDNLRASPFLLQYIQEEIPNYRNAVIVAKSPDA
AKRAQSYAERLRLGLAVIHGEAQCTELDMDDGRHSPPMVKNATVHPGLELPLMMAKEKPP
ITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKIYVMATHGILSAEAPRLIEES
SVDEVVVTNTVPHEVQKLQCPKIKTVDISLILSEAIRRIHNGESMAYLFRNITVDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14558	1.000	1.000	6.786E-76	356	1.000	1.000	Q14558.pdb.gz	KPRA_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens OX=9606 GN=PRPSAP1 PE=1 SV=2
2	AFDB:O08618	0.922	0.891	8.901E-62	369	0.787	0.759	O08618.pdb.gz	KPRB_RAT Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Prpsap2 PE=1 SV=1
3	PDB:2c4kA	0.842	0.982	2.065E-54	305	0.851	0.993	2c4kA.pdb.gz
4	PDB:2ji4A	0.822	0.968	2.144E-49	302	0.683	0.805	2ji4A.pdb.gz
5	AFDB:Q5BBW5	0.834	0.926	5.811E-41	320	0.419	0.466	Q5BBW5.pdb.gz	Q5BBW5_EMENI ribose-phosphate diphosphokinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01965 PE=3 SV=1
6	AFDB:Q9VT33	0.846	0.777	7.826E-41	388	0.421	0.387	Q9VT33.pdb.gz	Q9VT33_DROME ribose-phosphate diphosphokinase OS=Drosophila melanogaster OX=7227 GN=Prps PE=1 SV=3
7	AFDB:P38689	0.841	0.933	9.357E-41	320	0.404	0.450	P38689.pdb.gz	KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS3 PE=1 SV=1
8	AFDB:O94413	0.846	0.936	1.260E-40	321	0.421	0.467	O94413.pdb.gz	KPR2_SCHPO Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1620.06c PE=1 SV=1
9	AFDB:Q5ALK3	0.848	0.942	1.801E-40	320	0.396	0.441	Q5ALK3.pdb.gz	Q5ALK3_CANAL ribose-phosphate diphosphokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PRS1 PE=3 SV=1
10	AFDB:Q54PA9	0.838	0.939	5.260E-40	317	0.390	0.438	Q54PA9.pdb.gz	PRPSA_DICDI Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum OX=44689 GN=prsA PE=1 SV=1
11	AFDB:M0RBK1	0.837	0.935	1.285E-39	318	0.419	0.469	M0RBK1.pdb.gz	M0RBK1_RAT ribose-phosphate diphosphokinase OS=Rattus norvegicus OX=10116 GN=Prps1l1 PE=3 SV=1
12	PDB:4lygB	0.835	0.956	9.087E-39	310	0.407	0.468	4lygB.pdb.gz
13	AFDB:P38620	0.831	0.927	2.676E-38	318	0.376	0.421	P38620.pdb.gz	KPR2_YEAST Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS2 PE=1 SV=1
14	PDB:4s2uA	0.789	0.908	2.171E-33	308	0.351	0.406	4s2uA.pdb.gz	Crystal structure of the Phosphorybosylpyrophosphate synthetase from E. Coli
15	PDB:2jfuA	0.272	0.324	3.002E-4	271	0.107	0.140	2jfuA.pdb.gz
16	PDB:3sboC	0.267	0.229	3.589E-4	442	0.149	0.120	3sboC.pdb.gz
17	PDB:2ehjA	0.223	0.348	6.909E-4	208	0.056	0.096	2ehjA.pdb.gz
18	PDB:7f79C	0.263	0.221	8.260E-4	458	0.132	0.103	7f79C.pdb.gz	Crystal structure of glutamate dehydrogenase 3 from Candida albicans.
19	PDB:2iv7A	0.250	0.243	1.791E-3	370	0.143	0.138	2iv7A.pdb.gz	Insights Into the Synthesis of Lipopolysaccharide and Antibiotics Through the Structures of Two Retaining Glycosyltransferases from Family Gt4
20	PDB:5knyB	0.220	0.370	1.791E-3	187	0.053	0.102	5knyB.pdb.gz	Crystal structure of Mycobacterium tuberculosis hypoxanthine guanine phosphoribosyltransferase in complex with pyrrolidine nucleoside phosphonate

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08618	0.0	568	369	0.787	0.759	KPRB_RAT Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Prpsap2 PE=1 SV=1
2	O60256	0.0	566	369	0.787	0.759	KPRB_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2 PE=1 SV=1
3	Q14558	0.0	731	356	1.000	1.000	KPRA_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens OX=9606 GN=PRPSAP1 PE=1 SV=2
4	Q63468	0.0	723	356	0.986	0.986	KPRA_RAT Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Prpsap1 PE=1 SV=1
5	Q8R574	0.0	568	369	0.789	0.762	KPRB_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus OX=10090 GN=Prpsap2 PE=1 SV=1
6	O94413	8.30e-91	276	321	0.433	0.480	KPR2_SCHPO Ribose-phosphate pyrophosphokinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1620.06c PE=1 SV=1
7	Q9CS42	1.10e-90	276	318	0.427	0.478	PRPS2_MOUSE Ribose-phosphate pyrophosphokinase 2 OS=Mus musculus OX=10090 GN=Prps2 PE=1 SV=4
8	P09330	1.27e-90	276	318	0.427	0.478	PRPS2_RAT Ribose-phosphate pyrophosphokinase 2 OS=Rattus norvegicus OX=10116 GN=Prps2 PE=1 SV=3
9	M0RBK1	1.70e-90	276	318	0.424	0.475	M0RBK1_RAT ribose-phosphate diphosphokinase OS=Rattus norvegicus OX=10116 GN=Prps1l1 PE=3 SV=1
10	P11908	3.20e-90	275	318	0.424	0.475	PRPS2_HUMAN Ribose-phosphate pyrophosphokinase 2 OS=Homo sapiens OX=9606 GN=PRPS2 PE=1 SV=2
11	P60891	1.43e-89	273	318	0.421	0.472	PRPS1_HUMAN Ribose-phosphate pyrophosphokinase 1 OS=Homo sapiens OX=9606 GN=PRPS1 PE=1 SV=2
12	P60892	1.43e-89	273	318	0.421	0.472	PRPS1_RAT Ribose-phosphate pyrophosphokinase 1 OS=Rattus norvegicus OX=10116 GN=Prps1 PE=1 SV=2
13	Q9D7G0	1.43e-89	273	318	0.421	0.472	PRPS1_MOUSE Ribose-phosphate pyrophosphokinase 1 OS=Mus musculus OX=10090 GN=Prps1 PE=1 SV=4
14	Q9VT33	6.20e-89	274	388	0.427	0.392	Q9VT33_DROME ribose-phosphate diphosphokinase OS=Drosophila melanogaster OX=7227 GN=Prps PE=1 SV=3
15	Q5BBW5	1.13e-86	266	320	0.430	0.478	Q5BBW5_EMENI ribose-phosphate diphosphokinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_01965 PE=3 SV=1
16	P38689	1.62e-83	258	320	0.410	0.456	KPR3_YEAST Ribose-phosphate pyrophosphokinase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS3 PE=1 SV=1
17	Q54PA9	2.45e-82	255	317	0.410	0.461	PRPSA_DICDI Ribose-phosphate pyrophosphokinase A OS=Dictyostelium discoideum OX=44689 GN=prsA PE=1 SV=1
18	Q5ALK3	2.34e-81	252	320	0.399	0.444	Q5ALK3_CANAL ribose-phosphate diphosphokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PRS1 PE=3 SV=1
19	P38063	3.43e-74	234	326	0.379	0.414	KPR4_YEAST Ribose-phosphate pyrophosphokinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS4 PE=1 SV=3
20	P38620	3.65e-74	234	318	0.376	0.421	KPR2_YEAST Ribose-phosphate pyrophosphokinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRS2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00156 Pribosyltran	0.14	23.0	Phosphoribosyl transferase domain
2	PF13793 Pribosyltran_N	3.7e-35	131.8	N-terminal domain of ribose phosphate pyrophosphokinase
3	PF14572 Pribosyl_synth	6.4e-94	324.6	Phosphoribosyl synthetase-associated domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000002752

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000023478	0.979	Phosphoribosyl pyrophosphate synthetase-associated protein 2
2	61853.ENSNLEP00000011100	0.891	Phosphoribosyl pyrophosphate synthetase 2
3	61853.ENSNLEP00000016916	0.890	Phosphoribosyl pyrophosphate synthetase 1
4	61853.ENSNLEP00000021905	0.857	Influenza virus NS1A binding protein
5	61853.ENSNLEP00000008921	0.661	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2.
6	61853.ENSNLEP00000015126	0.661	Branched chain keto acid dehydrogenase E1, beta polypeptide
7	61853.ENSNLEP00000002649	0.640	Ring finger protein 157
8	61853.ENSNLEP00000007521	0.638	BLOC-1 related complex subunit 8
9	61853.ENSNLEP00000010578	0.638	KIAA1211
10	61853.ENSNLEP00000003515	0.637	Belongs to the G-protein coupled receptor 1 family.
11	61853.ENSNLEP00000003062	0.600	Matrix-remodelling associated 7
12	61853.ENSNLEP00000003066	0.598	annotation not available
13	61853.ENSNLEP00000007564	0.592	Transmembrane 6 superfamily member 2
14	61853.ENSNLEP00000014559	0.559	Cadherin 12
15	61853.ENSNLEP00000002569	0.538	Uncharacterized protein
16	61853.ENSNLEP00000008892	0.538	Acetyltransferase component of pyruvate dehydrogenase complex
17	61853.ENSNLEP00000014350	0.538	Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
18	61853.ENSNLEP00000019834	0.538	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
19	61853.ENSNLEP00000021782	0.538	Pyruvate dehydrogenase complex, component X
20	61853.ENSNLEP00000004830	0.527	Trifunctional purine biosynthetic protein adenosine-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0004749	0.999	ribose phosphate diphosphokinase activity
GO:0004857	0.996	enzyme inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044238	0.999	primary metabolic process
GO:0006807	0.998	nitrogen compound metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006139	0.993	nucleobase-containing compound metabolic process
GO:1901576	0.759	organic substance biosynthetic process
GO:0065007	0.569	biological regulation
GO:0044249	0.535	cellular biosynthetic process
GO:0019637	0.502	organophosphate metabolic process
GO:0050789	0.481	regulation of biological process
GO:0050794	0.456	regulation of cellular process
GO:0044281	0.422	small molecule metabolic process
GO:0044271	0.401	cellular nitrogen compound biosynthetic process
GO:0006796	0.395	phosphate-containing compound metabolic process
GO:0090407	0.358	organophosphate biosynthetic process
GO:0018130	0.307	heterocycle biosynthetic process
GO:1901362	0.305	organic cyclic compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	0.996	catalytic complex
GO:0061695	0.985	transferase complex, transferring phosphorus-containing groups
GO:0110165	0.871	cellular anatomical entity
GO:0005622	0.501	intracellular anatomical structure
GO:0005737	0.489	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15609	0.999	ATP + D-ribose 5-phosphate = 5-phospho-alpha-D-ribose 1-diphosphate + AMP + H(+)
EC:2.7.6.1	0.999	ribose-phosphate diphosphokinase.

[back to server]