StarFunc result for job id Q14562

User Input

>input (1220 residues)
MAVAVAMAGALIGSEPGPAEELAKLEYLSLVSKVCTELDNHLGINDKDLAEFVISLAEKN
TTFDTFKASLVKNGAEFTDSLISNLLRLIQTMRPPAKPSTSKDPVVKPKTEKEKLKELFP
VLCQPDNPSVRTMLDEDDVKVAVDVLKELEALMPSAAGQEKQRDAEHRDRTKKKKRSRSR
DRNRDRDRDRERNRDRDHKRRHRSRSRSRSRTRERNKVKSRYRSRSRSQSPPKDRKDRDK
YGERNLDRWRDKHVDRPPPEEPTIGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISEL
RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNRRRNLVGETNE
ETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKWEIKQMIAANVLSKEEFPDFD
EETGILPKVDDEEDEDLEIELVEEEPPFLRGHTKQSMDMSPIKIVKNPDGSLSQAAMMQS
ALAKERRELKQAQREAEMDSIPMGLNKHWVDPLPDAEGRQIAANMRGIGMMPNDIPEWKK
HAFGGNKASYGKKTQMSILEQRESLPIYKLKEQLVQAVHDNQILIVIGETGSGKTTQITQ
YLAEAGYTSRGKIGCTQPRRVAAMSVAKRVSEEFGCCLGQEVGYTIRFEDCTSPETVIKY
MTDGMLLRECLIDPDLTQYAIIMLDEAHERTIHTDVLFGLLKKTVQKRQDMKLIVTSATL
DAVKFSQYFYEAPIFTIPGRTYPVEILYTKEPETDYLDASLITVMQIHLTEPPGDILVFL
TGQEEIDTACEILYERMKSLGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATN
IAETSLTIDGIYYVVDPGFVKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCY
RLYTERAYRDEMLTTNVPEIQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQ
LYTLGALDDEGLLTRLGRRMAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYR
PKDKQALADQKKAKFHQTEGDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRK
QMLGIMDRHKLDVVSCGKSTVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSA
LFNRQPEWVVYHELVLTTKEYMREVTTIDPRWLVEFAPAFFKVSDPTKLSKQKKQQRLEP
LYNRYEEPNAWRISRAFRRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286Y8Y8	0.758	0.748	0.000	1238	0.904	0.891	A0A286Y8Y8.pdb.gz
2	AFDB:A1Z9L3	0.758	0.745	0.000	1242	0.710	0.697	A1Z9L3.pdb.gz	DHX8_DROME ATP-dependent RNA helicase DHX8 OS=Drosophila melanogaster OX=7227 GN=pea PE=1 SV=1
3	AFDB:Q14562	1.000	1.000	0.000	1220	1.000	1.000	Q14562.pdb.gz	DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1
4	AFDB:Q38953	0.681	0.709	0.000	1168	0.578	0.604	Q38953.pdb.gz	DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana OX=3702 GN=At3g26560 PE=1 SV=2
5	PDB:5xjcY	0.493	0.820	6.125E-97	713	0.584	0.999	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
6	AFDB:Q9P774	0.589	0.611	3.563E-93	1173	0.364	0.379	Q9P774.pdb.gz	PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp16 PE=3 SV=2
7	AFDB:Q38AN5	0.570	0.653	8.207E-90	1062	0.332	0.381	Q38AN5.pdb.gz	Q38AN5_TRYB2 Pre-mRNA splicing factor ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3410 PE=4 SV=1
8	AFDB:Q9VY54	0.566	0.566	8.121E-89	1222	0.358	0.358	Q9VY54.pdb.gz	Q9VY54_DROME LD24737p OS=Drosophila melanogaster OX=7227 GN=Prp16 PE=1 SV=2
9	AFDB:P34498	0.574	0.618	1.481E-87	1131	0.352	0.380	P34498.pdb.gz	MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans OX=6239 GN=mog-1 PE=1 SV=2
10	AFDB:F4IJV4	0.509	0.593	2.293E-85	1044	0.359	0.420	F4IJV4.pdb.gz	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1
11	AFDB:F1QU72	0.517	0.596	2.156E-84	1054	0.363	0.420	F1QU72.pdb.gz
12	PDB:5ylzW	0.488	0.820	1.551E-73	703	0.331	0.575	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
13	PDB:6ff7q	0.474	0.895	3.956E-70	625	0.298	0.582	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	PDB:6id1V	0.490	0.885	8.936E-70	663	0.278	0.511	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:3kx2B	0.479	0.756	1.595E-66	755	0.280	0.453	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
16	PDB:5wsge	0.481	0.842	7.889E-63	679	0.261	0.468	5wsge.pdb.gz	Structure of a yeast step II catalytically activated spliceosome
17	PDB:5yzgZ	0.475	0.895	1.071E-62	635	0.275	0.528	5yzgZ.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:7dcpx	0.478	0.849	1.382E-62	670	0.249	0.454	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
19	PDB:7dvqx	0.444	0.876	8.043E-60	599	0.283	0.576	7dvqx.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:5gm6Y	0.452	0.893	3.517E-54	598	0.240	0.490	5gm6Y.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1Z9L3	1564	1242	0.612	0.601	DHX8_DROME ATP-dependent RNA helicase DHX8 OS=Drosophila melanogaster OX=7227 GN=pea PE=1 SV=1
2	A2ACQ1	638	703	0.261	0.452	A2ACQ1_MOUSE RNA helicase OS=Mus musculus OX=10090 GN=Dhx35 PE=1 SV=1
3	D3ZD97	691	795	0.281	0.431	D3ZD97_RAT RNA helicase OS=Rattus norvegicus OX=10116 GN=Dhx15 PE=3 SV=1
4	D6XG53	590	735	0.252	0.418	D6XG53_TRYB2 Pre-mRNA splicing factor ATP-dependent RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.30H13.60 PE=4 SV=1
5	F4IE66	619	717	0.256	0.435	PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana OX=3702 GN=RID1 PE=1 SV=1
6	F4IJV4	803	1044	0.304	0.355	DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana OX=3702 GN=MEE29 PE=2 SV=1
7	F4JRJ6	617	695	0.255	0.447	DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana OX=3702 GN=At4g18465 PE=3 SV=1
8	F4K2E9	770	1255	0.318	0.309	PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana OX=3702 GN=CUV PE=1 SV=1
9	F5H658	2377	1181	0.940	0.971	F5H658_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1
10	O22899	714	729	0.284	0.476	PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana OX=3702 GN=At2g47250 PE=2 SV=1
11	O35286	691	795	0.281	0.431	DHX15_MOUSE ATP-dependent RNA helicase DHX15 OS=Mus musculus OX=10090 GN=Dhx15 PE=1 SV=2
12	O42643	1222	1168	0.522	0.545	PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp22 PE=1 SV=1
13	O42945	699	735	0.281	0.467	DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp43 PE=3 SV=1
14	O43143	692	795	0.281	0.431	DHX15_HUMAN ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2
15	O45244	788	1008	0.297	0.359	DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans OX=6239 GN=mog-4 PE=1 SV=2
16	O60231	811	1041	0.302	0.354	DHX16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2
17	P15938	638	1071	0.266	0.303	PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP16 PE=1 SV=2
18	P20095	597	876	0.254	0.354	PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP2 PE=1 SV=1
19	P24384	967	1145	0.406	0.432	PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRP22 PE=1 SV=1
20	P34498	765	1131	0.312	0.337	MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans OX=6239 GN=mog-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	1.7e+02	13.9	AAA ATPase domain
2	PF13245 AAA_19	9.1	17.9	AAA domain
3	PF13401 AAA_22	1	21.1	AAA domain
4	PF13604 AAA_30	1.2e+02	13.9	AAA domain
5	PF00270 DEAD	0.031	25.5	DEAD/DEAH box helicase
6	PF07652 Flavi_DEAD	70	14.8	Flavivirus DEAD domain
7	PF04408 HA2	4.3e-20	83.3	Helicase associated domain (HA2)
8	PF00271 Helicase_C	4.6e-10	51.2	Helicase conserved C-terminal domain
9	PF07717 OB_NTP_bind	2.6e-22	90.3	Oligonucleotide/oligosaccharide-binding (OB)-fold
10	PF02562 PhoH	1.3e+02	13.4	PhoH-like protein
11	PF00575 S1	8.5e-11	53.4	S1 RNA binding domain
12	PF14532 Sigma54_activ_2	3.2e+02	12.9	Sigma-54 interaction domain
13	PF00437 T2SSE	1.3e+02	13.0	Type II/IV secretion system protein
14	PF02367 TsaE	3.5e+02	12.5	Threonylcarbamoyl adenosine biosynthesis protein TsaE

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262415

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261531	0.999	SNW domain-containing protein 1
2	9606.ENSP00000351137	0.999	Pre-mRNA-splicing factor SYF1
3	9606.ENSP00000357928	0.999	Pre-mRNA-processing factor 17
4	9606.ENSP00000360532	0.999	Cell division cycle 5-like protein
5	9606.ENSP00000366557	0.999	Crooked neck-like protein 1
6	9606.ENSP00000387006	0.999	Pre-mRNA-splicing factor CWC22 homolog
7	9606.ENSP00000199814	0.998	Pre-mRNA-splicing factor RBM22
8	9606.ENSP00000227524	0.998	Pre-mRNA-processing factor 19
9	9606.ENSP00000254193	0.998	U2 small nuclear ribonucleoprotein A
10	9606.ENSP00000386023	0.998	Protein BUD31 homolog
11	9606.ENSP00000392094	0.998	116 kDa U5 small nuclear ribonucleoprotein component
12	9606.ENSP00000460348	0.998	Pre-mRNA-processing-splicing factor 8
13	9606.ENSP00000156471	0.997	Intron-binding protein aquarius
14	9606.ENSP00000297151	0.997	Pre-mRNA-splicing factor SLU7
15	9606.ENSP00000424417	0.997	Pleiotropic regulator 1
16	9606.ENSP00000475615	0.997	Spliceosome-associated protein CWC15 homolog
17	9606.ENSP00000215829	0.996	Small nuclear ribonucleoprotein Sm D3
18	9606.ENSP00000236273	0.996	Pre-mRNA-splicing factor SYF2
19	9606.ENSP00000300413	0.996	Small nuclear ribonucleoprotein Sm D1
20	9606.ENSP00000342374	0.996	Small nuclear ribonucleoprotein Sm D2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0008186	0.991	ATP-dependent activity, acting on RNA
GO:0140098	0.989	catalytic activity, acting on RNA
GO:0004386	0.988	helicase activity
GO:0003724	0.984	RNA helicase activity
GO:0042802	0.554	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008380	0.995	RNA splicing
GO:0006397	0.988	mRNA processing
GO:0000398	0.947	mRNA splicing, via spliceosome
GO:0050789	0.385	regulation of biological process
GO:0050794	0.379	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005829	0.985	cytosol
GO:0032991	0.976	protein-containing complex
GO:0016604	0.964	nuclear body
GO:1990904	0.889	ribonucleoprotein complex
GO:0140513	0.884	nuclear protein-containing complex
GO:0005681	0.867	spliceosomal complex
GO:1902494	0.788	catalytic complex
GO:0005684	0.721	U2-type spliceosomal complex
GO:0071013	0.707	catalytic step 2 spliceosome
GO:0016607	0.438	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.984	RNA helicase.

[back to server]