StarFunc result for job id Q14571

User Input

>input (1400 residues)
MTEKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGVPPTSKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSASGSPDTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGE
IGESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6dr0C	0.684	0.451	0.000	2193	0.642	0.410	6dr0C.pdb.gz	Structural basis for the regulation of inositol trisphosphate receptors by Ca2+and IP3.
2	PDB:6uqkA	0.798	0.548	0.000	2054	0.625	0.426	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.
3	PDB:7t3pA	0.626	0.443	0.000	2066	0.630	0.427	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
4	PDB:7t3qA	0.626	0.436	0.000	2103	0.633	0.421	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
5	PDB:7t3rA	0.624	0.430	0.000	2130	0.636	0.418	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
6	AFDB:A0A0R4IH08	0.915	0.491	0.000	2634	0.649	0.345	A0A0R4IH08.pdb.gz	A0A0R4IH08_DANRE Inositol 1,4,5-trisphosphate receptor OS=Danio rerio OX=7955 GN=si:dkey-163f12.8 PE=3 SV=2
7	AFDB:Q14573	0.905	0.480	0.000	2671	0.681	0.357	Q14573.pdb.gz	ITPR3_HUMAN Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2
8	PDB:7t3uA	0.464	0.341	1.331E-102	2020	0.611	0.423	7t3uA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
9	PDB:7lhfB	0.804	0.498	2.513E-93	2300	0.661	0.403	7lhfB.pdb.gz	Cryo-EM structure of type 1 IP3R channel in a lipid bilayer
10	PDB:6mu2A	0.728	0.481	1.103E-69	2170	0.622	0.401	6mu2A.pdb.gz
11	PDB:7t3uC	0.380	0.341	4.556E-58	1575	0.394	0.350	7t3uC.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
12	PDB:3javA	0.481	0.301	7.388E-40	2327	0.616	0.371	3javA.pdb.gz
13	AFDB:F1QLD3	0.131	0.755	9.930E-18	232	0.100	0.603	F1QLD3.pdb.gz
14	AFDB:F4I8B3	0.141	0.154	1.032E-4	1203	0.070	0.081	F4I8B3.pdb.gz	F4I8B3_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=HEB1 PE=1 SV=1
15	AFDB:Q59X23	0.105	0.189	1.257E-4	755	0.040	0.074	Q59X23.pdb.gz	PMT4_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
16	AFDB:F1Q8R9	0.110	0.196	1.655E-4	756	0.032	0.060	F1Q8R9.pdb.gz	POMT2_DANRE Protein O-mannosyl-transferase 2 OS=Danio rerio OX=7955 GN=pomt2 PE=1 SV=1
17	AFDB:Q9W5D4	0.110	0.198	1.862E-4	765	0.036	0.065	Q9W5D4.pdb.gz	POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster OX=7227 GN=tw PE=2 SV=1
18	AFDB:Q14U74	0.109	0.180	2.551E-4	820	0.035	0.060	Q14U74.pdb.gz	Q14U74_RAT Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Rattus norvegicus OX=10116 GN=Pomt2 PE=3 SV=1
19	AFDB:Q5SRE5	0.177	0.150	3.932E-4	1749	0.086	0.069	Q5SRE5.pdb.gz	NU188_HUMAN Nucleoporin NUP188 OS=Homo sapiens OX=9606 GN=NUP188 PE=1 SV=1
20	AFDB:Q4WCG5	0.100	0.175	4.425E-4	780	0.034	0.060	Q4WCG5.pdb.gz	Q4WCG5_ASPFU Dolichyl-phosphate-mannose--protein mannosyltransferase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_8G04500 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IH08	0.0	1830	2634	0.651	0.346	A0A0R4IH08_DANRE Inositol 1,4,5-trisphosphate receptor OS=Danio rerio OX=7955 GN=si:dkey-163f12.8 PE=3 SV=2
2	P11881	0.0	2014	2749	0.709	0.361	ITPR1_MOUSE Inositol 1,4,5-trisphosphate receptor type 1 OS=Mus musculus OX=10090 GN=Itpr1 PE=1 SV=2
3	P29993	0.0	1575	2838	0.605	0.298	ITPR_DROME Inositol 1,4,5-trisphosphate receptor OS=Drosophila melanogaster OX=7227 GN=Itpr PE=2 SV=3
4	P29994	0.0	2010	2750	0.710	0.361	ITPR1_RAT Inositol 1,4,5-trisphosphate receptor type 1 OS=Rattus norvegicus OX=10116 GN=Itpr1 PE=1 SV=2
5	P29995	0.0	2784	2701	0.956	0.496	ITPR2_RAT Inositol 1,4,5-trisphosphate receptor type 2 OS=Rattus norvegicus OX=10116 GN=Itpr2 PE=1 SV=1
6	P70227	0.0	1940	2670	0.681	0.357	ITPR3_MOUSE Inositol 1,4,5-trisphosphate receptor type 3 OS=Mus musculus OX=10090 GN=Itpr3 PE=1 SV=3
7	Q14571	0.0	2921	2701	1.000	0.518	ITPR2_HUMAN Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2
8	Q14573	0.0	1927	2671	0.684	0.358	ITPR3_HUMAN Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2
9	Q14643	0.0	2019	2758	0.711	0.361	ITPR1_HUMAN Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 PE=1 SV=3
10	Q63269	0.0	1947	2670	0.685	0.359	ITPR3_RAT Inositol 1,4,5-trisphosphate receptor type 3 OS=Rattus norvegicus OX=10116 GN=Itpr3 PE=1 SV=1
11	Q8WN95	0.0	1916	2664	0.682	0.358	ITPR3_BOVIN Inositol 1,4,5-trisphosphate receptor type 3 OS=Bos taurus OX=9913 GN=ITPR3 PE=2 SV=1
12	Q8WN96	0.0	2865	2701	0.979	0.507	ITPR2_BOVIN Inositol 1,4,5-trisphosphate receptor type 2 OS=Bos taurus OX=9913 GN=ITPR2 PE=2 SV=1
13	Q91908	0.0	1998	2693	0.700	0.364	Q91908_XENLA Inositol 1,4,5-trisphosphate receptor OS=Xenopus laevis OX=8355 GN=itpr1.S PE=1 SV=1
14	Q9TU34	0.0	2014	2709	0.706	0.365	ITPR1_BOVIN Inositol 1,4,5-trisphosphate receptor type 1 OS=Bos taurus OX=9913 GN=ITPR1 PE=1 SV=1
15	Q9Y0A1	0.0	891	2892	0.407	0.197	ITPR_CAEEL Inositol 1,4,5-trisphosphate receptor itr-1 OS=Caenorhabditis elegans OX=6239 GN=itr-1 PE=1 SV=1
16	Q9Z329	0.0	2795	2701	0.959	0.497	ITPR2_MOUSE Inositol 1,4,5-trisphosphate receptor type 2 OS=Mus musculus OX=10090 GN=Itpr2 PE=1 SV=4
17	A2AGL3	1.01e-24	115	4863	0.101	0.029	RYR3_MOUSE Ryanodine receptor 3 OS=Mus musculus OX=10090 GN=Ryr3 PE=1 SV=1
18	Q9TS33	2.63e-24	114	4872	0.100	0.029	RYR3_RABIT Ryanodine receptor 3 OS=Oryctolagus cuniculus OX=9986 GN=RYR3 PE=1 SV=1
19	Q15413	4.03e-23	110	4870	0.100	0.029	RYR3_HUMAN Ryanodine receptor 3 OS=Homo sapiens OX=9606 GN=RYR3 PE=1 SV=3
20	A6P4B8	2.09e-22	107	5076	0.109	0.030	A6P4B8_DANRE Ryanodine receptor 1 OS=Danio rerio OX=7955 GN=si:dkey-250i19.1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08709 Ins145_P3_rec	5.7e-85	295.3	Inositol 1,4,5-trisphosphate/ryanodine receptor
2	PF02815 MIR	6.1e-68	239.9	MIR domain
3	PF01365 RYDR_ITPR	6.4e-79	275.7	RIH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370744

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368966	0.972	Short transient receptor potential channel 3
2	9606.ENSP00000478059	0.969	Stromal interaction molecule 1
3	9606.ENSP00000349588	0.956	Ankyrin-2
4	9606.ENSP00000309591	0.931	cAMP-dependent protein kinase catalytic subunit alpha
5	9606.ENSP00000266505	0.923	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
6	9606.ENSP00000359719	0.918	cAMP-dependent protein kinase catalytic subunit beta
7	9606.ENSP00000366488	0.915	cAMP-dependent protein kinase catalytic subunit gamma
8	9606.ENSP00000482457	0.908	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
9	9606.ENSP00000244007	0.905	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
10	9606.ENSP00000419313	0.901	Short transient receptor potential channel 1
11	9606.ENSP00000280772	0.888	Ankyrin-3
12	9606.ENSP00000326366	0.877	Presenilin-1
13	9606.ENSP00000338185	0.876	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
14	9606.ENSP00000355747	0.867	Presenilin-2
15	9606.ENSP00000265709	0.863	Ankyrin-1
16	9606.ENSP00000480616	0.856	Calcium release-activated calcium channel protein 1
17	9606.ENSP00000360431	0.852	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
18	9606.ENSP00000348752	0.848	Protein orai-2
19	9606.ENSP00000408695	0.846	Protein kinase C alpha type
20	9606.ENSP00000412130	0.844	Protein MRVI1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005220	1.000	inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
GO:0043167	0.919	ion binding
GO:0043168	0.893	anion binding
GO:0036094	0.874	small molecule binding
GO:0043178	0.796	alcohol binding
GO:0070679	0.523	inositol 1,4,5 trisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.956	cellular process
GO:0065007	0.952	biological regulation
GO:0051716	0.944	cellular response to stimulus
GO:0050794	0.941	regulation of cellular process
GO:0006816	0.941	calcium ion transport
GO:0070482	0.902	response to oxygen levels
GO:0070588	0.855	calcium ion transmembrane transport
GO:0006950	0.813	response to stress
GO:0032501	0.749	multicellular organismal process
GO:0051283	0.748	negative regulation of sequestering of calcium ion
GO:0023052	0.724	signaling
GO:0097553	0.711	calcium ion transmembrane import into cytosol
GO:0042221	0.702	response to chemical
GO:0007154	0.702	cell communication
GO:0007165	0.678	signal transduction
GO:0010646	0.651	regulation of cell communication
GO:0070887	0.646	cellular response to chemical stimulus
GO:0065008	0.643	regulation of biological quality
GO:0071320	0.627	cellular response to cAMP
GO:0036293	0.588	response to decreased oxygen levels
GO:0023051	0.577	regulation of signaling
GO:0001666	0.503	response to hypoxia
GO:0003008	0.408	system process
GO:0050877	0.391	nervous system process
GO:1902074	0.380	response to salt
GO:0032502	0.329	developmental process
GO:0048856	0.318	anatomical structure development
GO:0051209	0.308	release of sequestered calcium ion into cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005783	1.000	endoplasmic reticulum
GO:0031090	0.982	organelle membrane
GO:0071944	0.969	cell periphery
GO:0042175	0.908	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0031984	0.907	organelle subcompartment
GO:0098827	0.861	endoplasmic reticulum subcompartment
GO:0098588	0.769	bounding membrane of organelle
GO:0031982	0.703	vesicle
GO:0005789	0.625	endoplasmic reticulum membrane
GO:0032991	0.600	protein-containing complex
GO:0005886	0.568	plasma membrane
GO:0016528	0.406	sarcoplasm
GO:0031095	0.370	platelet dense tubular network membrane
GO:0005634	0.305	nucleus
GO:0005829	0.302	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]