StarFunc result for job id Q14573

User Input

>input (2671 residues)
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGMGAQGRTGRRNAGEKIKYCLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQVFGILKAPFREKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIRTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEDPGGKNVRRSIQGVGHMMSTMVLSRKQSVFSAPSLSAGASAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAILLPMDLDAHISSMLSSGASCAA
AAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSTSRGDLPDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPHEDREPVDPTTKGRVASFSIPGSSSRYSLGPSLRRGHEVSERVQS
SEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSAPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLDSPLISLLFWILICFSIAALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPNNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGLSVPEVLEEDRELDSTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCISR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6dr0C	0.679	0.814	0.000	2193	0.805	0.981	6dr0C.pdb.gz	Structural basis for the regulation of inositol trisphosphate receptors by Ca2+and IP3.
2	PDB:6mu2A	0.727	0.884	0.000	2170	0.569	0.700	6mu2A.pdb.gz
3	PDB:6uqkA	0.726	0.934	0.000	2054	0.747	0.971	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.
4	PDB:7lhfB	0.784	0.905	0.000	2300	0.595	0.690	7lhfB.pdb.gz	Cryo-EM structure of type 1 IP3R channel in a lipid bilayer
5	PDB:7t3pA	0.636	0.800	0.000	2066	0.764	0.987	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
6	PDB:7t3qA	0.646	0.798	0.000	2103	0.778	0.989	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
7	PDB:7t3rA	0.644	0.790	0.000	2130	0.788	0.988	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
8	PDB:7t3uA	0.493	0.622	0.000	2020	0.751	0.994	7t3uA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
9	PDB:7t3uC	0.421	0.672	0.000	1575	0.588	0.997	7t3uC.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
10	AFDB:A0A0R4IH08	0.907	0.920	0.000	2634	0.739	0.749	A0A0R4IH08.pdb.gz	A0A0R4IH08_DANRE Inositol 1,4,5-trisphosphate receptor OS=Danio rerio OX=7955 GN=si:dkey-163f12.8 PE=3 SV=2
11	AFDB:Q14573	1.000	1.000	0.000	2671	1.000	1.000	Q14573.pdb.gz	ITPR3_HUMAN Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2
12	PDB:3javA	0.487	0.549	4.952E-59	2327	0.547	0.628	3javA.pdb.gz
13	AFDB:F1QLD3	0.066	0.751	4.719E-19	232	0.059	0.677	F1QLD3.pdb.gz
14	AFDB:Q90984	0.105	0.417	6.035E-10	606	0.042	0.183	Q90984.pdb.gz	Q90984_CHICK Ryanodine receptor type 1 (Fragment) OS=Gallus gallus OX=9031 GN=RyR1 PE=2 SV=1
15	AFDB:F5HSE3	0.080	0.086	3.954E-7	2381	0.068	0.076	F5HSE3.pdb.gz	NIPLA_DANRE Nipped-B-like protein A OS=Danio rerio OX=7955 GN=nipbla PE=2 SV=1
16	AFDB:Q9BZ29	0.078	0.087	5.189E-7	2069	0.078	0.101	Q9BZ29.pdb.gz	DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2
17	AFDB:Q7TSU1	0.077	0.094	1.044E-6	1791	0.066	0.098	Q7TSU1.pdb.gz	BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus OX=10116 GN=Arfgef2 PE=1 SV=1
18	AFDB:Q95XZ5	0.086	0.097	5.544E-6	2176	0.066	0.080	Q95XZ5.pdb.gz	NIPBL_CAEEL Nipped-B-like protein scc-2 OS=Caenorhabditis elegans OX=6239 GN=scc-2 PE=1 SV=3
19	AFDB:P43583	0.099	0.112	1.159E-5	2143	0.069	0.085	P43583.pdb.gz	BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BLM10 PE=1 SV=2
20	AFDB:Q9Y6D6	0.076	0.097	1.253E-5	1849	0.077	0.111	Q9Y6D6.pdb.gz	BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens OX=9606 GN=ARFGEF1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IH08	0.0	3942	2634	0.745	0.755	A0A0R4IH08_DANRE Inositol 1,4,5-trisphosphate receptor OS=Danio rerio OX=7955 GN=si:dkey-163f12.8 PE=3 SV=2
2	P11881	0.0	3359	2749	0.639	0.621	ITPR1_MOUSE Inositol 1,4,5-trisphosphate receptor type 1 OS=Mus musculus OX=10090 GN=Itpr1 PE=1 SV=2
3	P29993	0.0	2678	2838	0.557	0.524	ITPR_DROME Inositol 1,4,5-trisphosphate receptor OS=Drosophila melanogaster OX=7227 GN=Itpr PE=2 SV=3
4	P29994	0.0	3354	2750	0.639	0.621	ITPR1_RAT Inositol 1,4,5-trisphosphate receptor type 1 OS=Rattus norvegicus OX=10116 GN=Itpr1 PE=1 SV=2
5	P29995	0.0	3494	2701	0.661	0.654	ITPR2_RAT Inositol 1,4,5-trisphosphate receptor type 2 OS=Rattus norvegicus OX=10116 GN=Itpr2 PE=1 SV=1
6	P70227	0.0	5217	2670	0.953	0.953	ITPR3_MOUSE Inositol 1,4,5-trisphosphate receptor type 3 OS=Mus musculus OX=10090 GN=Itpr3 PE=1 SV=3
7	Q14571	0.0	3491	2701	0.662	0.654	ITPR2_HUMAN Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2
8	Q14573	0.0	5566	2671	1.000	1.000	ITPR3_HUMAN Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2
9	Q14643	0.0	3360	2758	0.640	0.620	ITPR1_HUMAN Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 PE=1 SV=3
10	Q63269	0.0	5188	2670	0.952	0.952	ITPR3_RAT Inositol 1,4,5-trisphosphate receptor type 3 OS=Rattus norvegicus OX=10116 GN=Itpr3 PE=1 SV=1
11	Q8WN95	0.0	5382	2664	0.966	0.968	ITPR3_BOVIN Inositol 1,4,5-trisphosphate receptor type 3 OS=Bos taurus OX=9913 GN=ITPR3 PE=2 SV=1
12	Q8WN96	0.0	3468	2701	0.659	0.652	ITPR2_BOVIN Inositol 1,4,5-trisphosphate receptor type 2 OS=Bos taurus OX=9913 GN=ITPR2 PE=2 SV=1
13	Q91908	0.0	3303	2693	0.633	0.628	Q91908_XENLA Inositol 1,4,5-trisphosphate receptor OS=Xenopus laevis OX=8355 GN=itpr1.S PE=1 SV=1
14	Q9TU34	0.0	3350	2709	0.631	0.622	ITPR1_BOVIN Inositol 1,4,5-trisphosphate receptor type 1 OS=Bos taurus OX=9913 GN=ITPR1 PE=1 SV=1
15	Q9Y0A1	0.0	1693	2892	0.409	0.378	ITPR_CAEEL Inositol 1,4,5-trisphosphate receptor itr-1 OS=Caenorhabditis elegans OX=6239 GN=itr-1 PE=1 SV=1
16	Q9Z329	0.0	3502	2701	0.662	0.655	ITPR2_MOUSE Inositol 1,4,5-trisphosphate receptor type 2 OS=Mus musculus OX=10090 GN=Itpr2 PE=1 SV=4
17	Q57XB2	4.59e-50	200	3099	0.060	0.052	Q57XB2_TRYB2 Inositol 1,4,5-trisphosphate receptor OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26A17.880 PE=4 SV=1
18	A6P4B8	8.26e-42	173	5076	0.036	0.019	A6P4B8_DANRE Ryanodine receptor 1 OS=Danio rerio OX=7955 GN=si:dkey-250i19.1 PE=1 SV=1
19	P21817	9.71e-41	169	5038	0.036	0.019	RYR1_HUMAN Ryanodine receptor 1 OS=Homo sapiens OX=9606 GN=RYR1 PE=1 SV=3
20	G1U7D3	1.38e-40	169	4598	0.036	0.021	G1U7D3_RABIT Ryanodine receptor 1 OS=Oryctolagus cuniculus OX=9986 GN=RYR1 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08709 Ins145_P3_rec	1.4e-91	317.0	Inositol 1,4,5-trisphosphate/ryanodine receptor
2	PF00520 Ion_trans	4.3e-12	57.4	Ion transport protein
3	PF02815 MIR	3.8e-65	230.7	MIR domain
4	PF08454 RIH_assoc	9.3e-27	104.2	RyR and IP3R Homology associated
5	PF01365 RYDR_ITPR	4.3e-77	269.7	RIH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363435

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419313	0.994	Short transient receptor potential channel 1
2	9606.ENSP00000478059	0.994	Stromal interaction molecule 1
3	9606.ENSP00000355231	0.993	Beclin-1
4	9606.ENSP00000297185	0.991	Stress-70 protein, mitochondrial
5	9606.ENSP00000265333	0.990	Voltage-dependent anion-selective channel protein 1
6	9606.ENSP00000349588	0.986	Ankyrin-2
7	9606.ENSP00000451828	0.980	RAC-alpha serine/threonine-protein kinase
8	9606.ENSP00000277010	0.957	Sigma non-opioid intracellular receptor 1
9	9606.ENSP00000368966	0.957	Short transient receptor potential channel 3
10	9606.ENSP00000244007	0.948	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
11	9606.ENSP00000266505	0.938	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1
12	9606.ENSP00000377036	0.936	Serine/threonine-protein phosphatase 2A activator
13	9606.ENSP00000482457	0.934	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
14	9606.ENSP00000366488	0.926	cAMP-dependent protein kinase catalytic subunit gamma
15	9606.ENSP00000412130	0.926	Protein MRVI1
16	9606.ENSP00000359719	0.925	cAMP-dependent protein kinase catalytic subunit beta
17	9606.ENSP00000309591	0.923	cAMP-dependent protein kinase catalytic subunit alpha
18	9606.ENSP00000480616	0.922	Calcium release-activated calcium channel protein 1
19	9606.ENSP00000260402	0.914	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
20	9606.ENSP00000340913	0.911	Short transient receptor potential channel 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005220	0.999	inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
GO:0043167	0.975	ion binding
GO:0043178	0.967	alcohol binding
GO:0043168	0.924	anion binding
GO:0070679	0.695	inositol 1,4,5 trisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.990	response to stimulus
GO:0050789	0.986	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0051716	0.980	cellular response to stimulus
GO:0010243	0.936	response to organonitrogen compound
GO:0006816	0.929	calcium ion transport
GO:0032501	0.922	multicellular organismal process
GO:0070588	0.875	calcium ion transmembrane transport
GO:0065008	0.866	regulation of biological quality
GO:0014074	0.861	response to purine-containing compound
GO:0007204	0.846	positive regulation of cytosolic calcium ion concentration
GO:0070887	0.831	cellular response to chemical stimulus
GO:0046683	0.818	response to organophosphorus
GO:0023052	0.815	signaling
GO:0003008	0.810	system process
GO:0007165	0.797	signal transduction
GO:0006950	0.796	response to stress
GO:0010646	0.790	regulation of cell communication
GO:1901700	0.789	response to oxygen-containing compound
GO:0050877	0.788	nervous system process
GO:0048518	0.784	positive regulation of biological process
GO:1901701	0.779	cellular response to oxygen-containing compound
GO:0071495	0.771	cellular response to endogenous stimulus
GO:0023051	0.752	regulation of signaling
GO:0071320	0.752	cellular response to cAMP
GO:0097553	0.703	calcium ion transmembrane import into cytosol
GO:0048522	0.678	positive regulation of cellular process
GO:0048519	0.651	negative regulation of biological process
GO:0050909	0.601	sensory perception of taste
GO:0070482	0.555	response to oxygen levels
GO:0001666	0.545	response to hypoxia
GO:0048523	0.484	negative regulation of cellular process
GO:0032879	0.473	regulation of localization
GO:1902074	0.471	response to salt
GO:0032502	0.368	developmental process
GO:0051282	0.339	regulation of sequestering of calcium ion
GO:0048856	0.326	anatomical structure development
GO:0048583	0.301	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005783	0.999	endoplasmic reticulum
GO:0031984	0.988	organelle subcompartment
GO:0031090	0.983	organelle membrane
GO:0042175	0.976	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0071944	0.944	cell periphery
GO:0005886	0.843	plasma membrane
GO:0005789	0.843	endoplasmic reticulum membrane
GO:0098588	0.791	bounding membrane of organelle
GO:0005634	0.771	nucleus
GO:0031982	0.758	vesicle
GO:0032991	0.649	protein-containing complex
GO:0070013	0.505	intracellular organelle lumen
GO:0005829	0.462	cytosol
GO:0031981	0.406	nuclear lumen
GO:0031095	0.376	platelet dense tubular network membrane
GO:0005654	0.314	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.999	Ca(2+)(in) = Ca(2+)(out)

[back to server]