StarFunc result for job id Q14582

User Input

>input (209 residues)
MELNSLLILLEAAEYLERRDREAEHGYASVLPFDGDFAREKTKAAGLVRKAPNNRSSHNE
LEKHRRAKLRLYLEQLKQLVPLGPDSTRHTTLSLLKRAKVHIKKLEEQDRRALSIKEQLQ
QEHRFLKRRLEQLSVQSVERVRTDSTGSAVSTDDSEQEVDIEGMEFGPGELDSVGSSSDA
DDHYSLQSGTGGDSGFGPHCRRLGRPALS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14582	1.000	1.000	8.826E-31	209	1.000	1.000	Q14582.pdb.gz	MAD4_HUMAN Max dimerization protein 4 OS=Homo sapiens OX=9606 GN=MXD4 PE=1 SV=2
2	AFDB:O09015	0.450	0.415	7.106E-15	228	0.531	0.487	O09015.pdb.gz	MXI1_RAT Max-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Mxi1 PE=2 SV=1
3	AFDB:Q05195	0.462	0.439	1.240E-14	221	0.474	0.448	Q05195.pdb.gz	MAD1_HUMAN Max dimerization protein 1 OS=Homo sapiens OX=9606 GN=MXD1 PE=1 SV=1
4	AFDB:P50538	0.440	0.406	5.738E-14	227	0.464	0.427	P50538.pdb.gz	MAD1_MOUSE Max dimerization protein 1 OS=Mus musculus OX=10090 GN=Mxd1 PE=1 SV=2
5	AFDB:Q80US8	0.426	0.434	2.123E-10	206	0.416	0.422	Q80US8.pdb.gz	MAD3_MOUSE Max dimerization protein 3 OS=Mus musculus OX=10090 GN=Mxd3 PE=1 SV=1
6	AFDB:Q9BW11	0.441	0.447	6.034E-10	206	0.426	0.432	Q9BW11.pdb.gz	MAD3_HUMAN Max dimerization protein 3 OS=Homo sapiens OX=9606 GN=MXD3 PE=1 SV=1
7	AFDB:F6U3F6	0.424	0.394	1.378E-7	226	0.373	0.345	F6U3F6.pdb.gz	F6U3F6_HUMAN MAX interactor 1, dimerization protein (Fragment) OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=1
8	AFDB:G5EG44	0.399	0.300	2.073E-5	281	0.239	0.178	G5EG44.pdb.gz	MDL1_CAEEL Mad-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=mdl-1 PE=1 SV=1
9	AFDB:O08789	0.379	0.140	1.924E-4	591	0.215	0.076	O08789.pdb.gz	MNT_MOUSE Max-binding protein MNT OS=Mus musculus OX=10090 GN=Mnt PE=2 SV=2
10	AFDB:M9NDN0	0.409	0.149	1.176E-3	583	0.187	0.067	M9NDN0.pdb.gz	M9NDN0_DROME Mnt, isoform J OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
11	PDB:3ojaA	0.270	0.138	2.991	482	0.072	0.031	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
12	PDB:6ff7K	0.229	0.225	4.237	213	0.086	0.085	6ff7K.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
13	PDB:6m5rC	0.128	0.250	4.542	105	0.081	0.162	6m5rC.pdb.gz	Architecture of the herpesvirus genome-packaging complex and implications for DNA translocation.
14	PDB:7yyhK	0.156	0.150	4.870	217	0.110	0.106	7yyhK.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
15	PDB:5jk7F	0.121	0.288	6.434	74	0.062	0.176	5jk7F.pdb.gz
16	PDB:5tbyA	0.134	0.045	6.434	954	0.124	0.027	5tbyA.pdb.gz
17	PDB:3b0dC	0.134	0.257	9.113	75	0.072	0.200	3b0dC.pdb.gz
18	PDB:5gm6A	0.119	0.019	9.113	2200	0.077	0.007	5gm6A.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:5y26B	0.146	0.306	9.113	92	0.029	0.065	5y26B.pdb.gz
20	PDB:6nd1E	0.124	0.179	9.113	139	0.091	0.137	6nd1E.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14582	1.32e-151	420	209	1.000	1.000	MAD4_HUMAN Max dimerization protein 4 OS=Homo sapiens OX=9606 GN=MXD4 PE=1 SV=2
2	Q60948	1.22e-121	345	209	0.828	0.828	MAD4_MOUSE Max dimerization protein 4 OS=Mus musculus OX=10090 GN=Mxd4 PE=1 SV=1
3	P50540	6.37e-61	191	228	0.541	0.496	MXI1_MOUSE Max-interacting protein 1 OS=Mus musculus OX=10090 GN=Mxi1 PE=1 SV=1
4	O09015	1.66e-60	190	228	0.526	0.482	MXI1_RAT Max-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Mxi1 PE=2 SV=1
5	P50539	1.05e-58	186	228	0.522	0.478	MXI1_HUMAN Max-interacting protein 1 OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=2
6	P50538	5.53e-54	174	227	0.512	0.471	MAD1_MOUSE Max dimerization protein 1 OS=Mus musculus OX=10090 GN=Mxd1 PE=1 SV=2
7	B1ANN8	3.51e-52	169	218	0.493	0.472	B1ANN8_HUMAN MAX interactor 1, dimerization protein OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=1
8	Q05195	1.32e-48	160	221	0.435	0.412	MAD1_HUMAN Max dimerization protein 1 OS=Homo sapiens OX=9606 GN=MXD1 PE=1 SV=1
9	A0A0S2Z3Y0	6.07e-48	157	192	0.431	0.469	A0A0S2Z3Y0_HUMAN MAX interactor 1 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=MXI1 PE=2 SV=1
10	Q9BW11	1.19e-38	134	206	0.397	0.403	MAD3_HUMAN Max dimerization protein 3 OS=Homo sapiens OX=9606 GN=MXD3 PE=1 SV=1
11	F6U3F6	7.88e-37	130	226	0.373	0.345	F6U3F6_HUMAN MAX interactor 1, dimerization protein (Fragment) OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=1
12	C9JBE8	1.30e-34	123	181	0.325	0.376	C9JBE8_HUMAN MAX dimerization protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=MXD1 PE=1 SV=1
13	Q80US8	3.85e-33	120	206	0.306	0.311	MAD3_MOUSE Max dimerization protein 3 OS=Mus musculus OX=10090 GN=Mxd3 PE=1 SV=1
14	F6WCI9	3.81e-29	107	118	0.273	0.483	F6WCI9_HUMAN MAX interactor 1, dimerization protein (Fragment) OS=Homo sapiens OX=9606 GN=MXI1 PE=1 SV=1
15	G5EG44	2.16e-12	66.6	281	0.234	0.174	MDL1_CAEEL Mad-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=mdl-1 PE=1 SV=1
16	Q7ZVS9	4.27e-09	57.4	396	0.144	0.076	MYCB_DANRE Transcriptional regulator Myc-B OS=Danio rerio OX=7955 GN=mycb PE=2 SV=1
17	P52160	1.92e-06	49.7	408	0.139	0.071	MYCA_DANRE Transcriptional regulator Myc-A OS=Danio rerio OX=7955 GN=myca PE=2 SV=3
18	B2KUA9	5.24e-06	48.5	360	0.134	0.078	B2KUA9_DANRE Transcriptional regulator OS=Danio rerio OX=7955 GN=id:ibd5144 PE=2 SV=1
19	M9NGP0	2.14e-05	47.0	790	0.129	0.034	M9NGP0_DROME Mnt, isoform I OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1
20	E1JJE8	2.16e-05	47.0	789	0.129	0.034	E1JJE8_DROME Mnt, isoform F OS=Drosophila melanogaster OX=7227 GN=Mnt PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	2.5e-07	41.9	Helix-loop-helix DNA-binding domain
2	PF14694 LINES_N	9.3e+02	10.6	Lines N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337889

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246912	0.963	Max-like protein X
2	9606.ENSP00000342235	0.905	Receptor tyrosine-protein kinase erbB-4
3	9606.ENSP00000351490	0.870	Protein max
4	9606.ENSP00000174618	0.815	Max-binding protein MNT
5	9606.ENSP00000320886	0.802	Carbohydrate-responsive element-binding protein
6	9606.ENSP00000312834	0.800	MLX-interacting protein
7	9606.ENSP00000300258	0.782	T-complex protein 10A homolog 2
8	9606.ENSP00000386394	0.764	NIF3-like protein 1
9	9606.ENSP00000339933	0.643	Pyruvate kinase PKLR
10	9606.ENSP00000466799	0.643	Estradiol 17-beta-dehydrogenase 1
11	9606.ENSP00000290974	0.634	Lateral signaling target protein 2 homolog
12	9606.ENSP00000215912	0.620	Phosphoinositide-3-kinase-interacting protein 1
13	9606.ENSP00000378402	0.616	Paired amphipathic helix protein Sin3a
14	9606.ENSP00000302114	0.612	PRELI domain-containing protein 1, mitochondrial
15	9606.ENSP00000368389	0.604	Neugrin
16	9606.ENSP00000384863	0.578	Exportin-1
17	9606.ENSP00000318687	0.545	Heat shock protein 105 kDa
18	9606.ENSP00000219905	0.518	MAX gene-associated protein
19	9606.ENSP00000410862	0.517	RUN domain-containing protein 3A
20	9606.ENSP00000248933	0.512	Seizure 6-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.990	DNA binding
GO:0043565	0.973	sequence-specific DNA binding
GO:1990837	0.931	sequence-specific double-stranded DNA binding
GO:0140110	0.924	transcription regulator activity
GO:0003700	0.911	DNA-binding transcription factor activity
GO:0000976	0.862	transcription cis-regulatory region binding
GO:0000981	0.622	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.591	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.998	regulation of primary metabolic process
GO:0060255	0.997	regulation of macromolecule metabolic process
GO:0051171	0.997	regulation of nitrogen compound metabolic process
GO:0031323	0.997	regulation of cellular metabolic process
GO:0009889	0.995	regulation of biosynthetic process
GO:0010468	0.992	regulation of gene expression
GO:0010556	0.992	regulation of macromolecule biosynthetic process
GO:0031326	0.989	regulation of cellular biosynthetic process
GO:0051252	0.987	regulation of RNA metabolic process
GO:1903506	0.976	regulation of nucleic acid-templated transcription
GO:0006357	0.966	regulation of transcription by RNA polymerase II
GO:0048523	0.963	negative regulation of cellular process
GO:0009892	0.955	negative regulation of metabolic process
GO:0000122	0.947	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0032991	0.990	protein-containing complex
GO:0005737	0.783	cytoplasm
GO:0005829	0.738	cytosol
GO:0140513	0.431	nuclear protein-containing complex
GO:0005667	0.422	transcription regulator complex
GO:0090575	0.320	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]