StarFunc result for job id Q14585

User Input

>input (488 residues)
MENLTKHSIECSSFRGDWECKNQFERKQGSQEGHFSEMIFTPEDMPTFSIQHQRIHTDEK
LLECKECGKDFSFVSVLVRHQRIHTGEKPYECKECGKAFGSGANLAYHQRIHTGEKPFEC
KECGKAFGSGSNLTHHQRIHTGEKPYECKECGKAFSFGSGLIRHQIIHSGEKPYECKECG
KSFSFESALIRHHRIHTGEKPYECIDCGKAFGSGSNLTQHRRIHTGEKPYECKACGMAFS
SGSALTRHQRIHTGEKPYICNECGKAFSFGSALTRHQRIHTGEKPYVCKECGKAFNSGSD
LTQHQRIHTGEKPYECKECEKAFRSGSKLIQHQRMHTGEKPYECKECGKTFSSGSDLTQH
HRIHTGEKPYECKECGKAFGSGSKLIQHQLIHTGERPYECKECGKSFSSGSALNRHQRIH
TGEKPYECKECGKAFYSGSSLTQHQRIHTGEKLYECKNCGKAYGRDSEFQQHKKSHNGKK
LCELETIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14585	1.000	1.000	6.002E-80	488	1.000	1.000	Q14585.pdb.gz	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
2	AFDB:Q6ECI4	0.658	0.473	1.187E-55	717	0.605	0.411	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
3	AFDB:Q9BX82	0.574	0.474	4.146E-55	626	0.578	0.450	Q9BX82.pdb.gz	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
4	AFDB:P17027	0.630	0.502	2.935E-54	643	0.547	0.415	P17027.pdb.gz	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
5	AFDB:Q8TAQ5	0.660	0.490	3.272E-54	688	0.625	0.443	Q8TAQ5.pdb.gz	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
6	AFDB:P52742	0.645	0.503	3.648E-54	658	0.555	0.412	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
7	AFDB:Q7Z3V5	0.505	0.420	5.636E-54	609	0.582	0.466	Q7Z3V5.pdb.gz	ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens OX=9606 GN=ZNF571 PE=2 SV=3
8	AFDB:A0A0U1RQ46	0.629	0.523	7.810E-54	609	0.533	0.427	A0A0U1RQ46.pdb.gz	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
9	AFDB:Q06732	0.456	0.308	1.025E-53	778	0.561	0.352	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
10	AFDB:O75290	0.491	0.397	1.765E-53	641	0.561	0.427	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
11	PDB:3w5kB	0.097	0.261	2.646E-4	110	0.082	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7evoC	0.077	0.084	6.647E-1	422	0.094	0.109	7evoC.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
13	PDB:6ydhA	0.032	0.184	7.825E-1	62	0.033	0.258	6ydhA.pdb.gz
14	PDB:4fjcE	0.064	0.069	8.262E-1	434	0.066	0.074	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
15	PDB:7ena4	0.079	0.082	1.145	457	0.072	0.077	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
16	PDB:6lsr0	0.055	0.122	1.348	190	0.066	0.168	6lsr0.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
17	PDB:7d5sRO	0.096	0.091	1.348	525	0.090	0.084	7d5sRO.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
18	PDB:5c8dE	0.099	0.142	1.423	280	0.047	0.082	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
19	PDB:5dkaA	0.063	0.223	1.423	96	0.033	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
20	PDB:4kfzB	0.064	0.151	1.503	148	0.057	0.189	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	0.0	523	616	0.529	0.419	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75290	0.0	551	641	0.580	0.441	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
3	P15620	0.0	524	580	0.520	0.438	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
4	P17020	0.0	528	682	0.533	0.381	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
5	P17027	0.0	530	643	0.529	0.401	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
6	P35789	0.0	524	620	0.512	0.403	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
7	P51523	0.0	526	738	0.570	0.377	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
8	P52742	0.0	526	658	0.541	0.401	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
9	Q03923	0.0	537	595	0.535	0.439	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
10	Q14585	0.0	984	488	1.000	1.000	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
11	Q49A12	0.0	535	536	0.535	0.487	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
12	Q5MCW4	0.0	526	686	0.541	0.385	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
13	Q6ECI4	0.0	560	717	0.564	0.384	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
14	Q7TMN8	0.0	568	578	0.584	0.493	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
15	Q7Z3V5	0.0	561	609	0.584	0.468	ZN571_HUMAN Zinc finger protein 571 OS=Homo sapiens OX=9606 GN=ZNF571 PE=2 SV=3
16	Q8BLA2	0.0	568	578	0.584	0.493	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
17	Q8TAQ5	0.0	596	688	0.613	0.435	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
18	Q9BX82	0.0	546	626	0.586	0.457	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
19	P17038	5.30e-180	526	809	0.527	0.318	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
20	Q05481	1.76e-179	536	1191	0.549	0.225	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19414 Astro_p19	28	15.6	Astrovirus p19 protein
2	PF07975 C1_4	3.1e-07	41.8	TFIIH C1-like domain
3	PF14743 DNA_ligase_OB_2	0.24	22.8	DNA ligase OB-like domain
4	PF12552 DUF3741	0.00041	31.5	Protein of unknown function (DUF3741)
5	PF19148 DUF5830	0.0065	27.8	Family of unknown function (DUF5830)
6	PF16113 ECH_2	2.1e+02	12.9	Enoyl-CoA hydratase/isomerase
7	PF01363 FYVE	0.0048	28.3	FYVE zinc finger
8	PF01927 Mut7-C	5.6e+02	12.0	Mut7-C RNAse domain
9	PF15967 Nucleoporin_FG2	73	13.3	Nucleoporin FG repeated region
10	PF01096 TFIIS_C	1.4e+02	13.7	Transcription factor S-II (TFIIS)
11	PF01286 XPA_N	1.9e-07	42.3	XPA protein N-terminal
12	PF01428 zf-AN1	0.35	22.4	AN1-like Zinc finger
13	PF00096 zf-C2H2	8.2e-78	263.9	Zinc finger, C2H2 type
14	PF16622 zf-C2H2_11	2.1e-24	96.2	zinc-finger C2H2-type
15	PF18868 zf-C2H2_3rep	0.00055	32.0	Zinc finger C2H2-type, 3 repeats
16	PF13894 zf-C2H2_4	5.7e-51	177.7	C2H2-type zinc finger
17	PF13912 zf-C2H2_6	1e-48	173.7	C2H2-type zinc finger
18	PF15909 zf-C2H2_8	0.00014	33.5	C2H2-type zinc ribbon
19	PF12171 zf-C2H2_jaz	1.5e-36	135.2	Zinc-finger double-stranded RNA-binding
20	PF13465 zf-H2C2_2	3.5e-141	465.3	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000431202

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307746	0.580	Zinc finger protein 608
2	9606.ENSP00000429367	0.548	Protein FAM92A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.992	protein binding
GO:1990837	0.513	sequence-specific double-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.972	regulation of biological process
GO:0050794	0.928	regulation of cellular process
GO:0009987	0.911	cellular process
GO:0048519	0.843	negative regulation of biological process
GO:0051171	0.821	regulation of nitrogen compound metabolic process
GO:0080090	0.819	regulation of primary metabolic process
GO:0060255	0.815	regulation of macromolecule metabolic process
GO:0048523	0.810	negative regulation of cellular process
GO:0044237	0.765	cellular metabolic process
GO:0071704	0.763	organic substance metabolic process
GO:0044238	0.751	primary metabolic process
GO:0010605	0.740	negative regulation of macromolecule metabolic process
GO:0006807	0.724	nitrogen compound metabolic process
GO:0010556	0.707	regulation of macromolecule biosynthetic process
GO:0031326	0.707	regulation of cellular biosynthetic process
GO:0019219	0.698	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.556	regulation of DNA-templated transcription
GO:0006139	0.506	nucleobase-containing compound metabolic process
GO:0043170	0.503	macromolecule metabolic process
GO:0051172	0.479	negative regulation of nitrogen compound metabolic process
GO:0090304	0.441	nucleic acid metabolic process
GO:1901576	0.420	organic substance biosynthetic process
GO:0044249	0.420	cellular biosynthetic process
GO:0045934	0.349	negative regulation of nucleobase-containing compound metabolic process
GO:0034654	0.314	nucleobase-containing compound biosynthetic process
GO:0009059	0.302	macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043233	0.926	organelle lumen
GO:0070013	0.924	intracellular organelle lumen
GO:0031981	0.913	nuclear lumen
GO:0005654	0.873	nucleoplasm
GO:0005737	0.492	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]