StarFunc result for job id Q14586

User Input

>input (743 residues)
MGLLTFRDVAVEFSLEEWEHLEPAQKNLYQDVMLENYRNLVSLGLVVSKPDLITFLEQRK
EPWNVKSEETVAIQPDVFSHYNKDLLTEHCTEASFQKVISRRHGSCDLENLHLRKRWKRE
ECEGHNGCYDEKTFKYDQFDESSVESLFHQQILSSCAKSYNFDQYRKVFTHSSLLNQQEE
IDIWGKHHIYDKTSVLFRQVSTLNSYRNVFIGEKNYHCNNSEKTLNQSSSPKNHQENYFL
EKQYKCKEFEEVFLQSMHGQEKQEQSYKCNKCVEVCTQSLKHIQHQTIHIRENSYSYNKY
DKDLSQSSNLRKQIIHNEEKPYKCEKCGDSLNHSLHLTQHQIIPTEEKPCKWKECGKVFN
LNCSLYLTKQQQIDTGENLYKCKACSKSFTRSSNLIVHQRIHTGEKPYKCKECGKAFRCS
SYLTKHKRIHTGEKPYKCKECGKAFNRSSCLTQHQTTHTGEKLYKCKVCSKSYARSSNLI
MHQRVHTGEKPYKCKECGKVFSRSSCLTQHRKIHTGENLYKCKVCAKPFTCFSNLIVHER
IHTGEKPYKCKECGKAFPYSSHLIRHHRIHTGEKPYKCKACSKSFSDSSGLTVHRRTHTG
EKPYTCKECGKAFSYSSDVIQHRRIHTGQRPYKCEECGKAFNYRSYLTTHQRSHTGERPY
KCEECGKAFNSRSYLTTHRRRHTGERPYKCDECGKAFSYRSYLTTHRRSHSGERPYKCEE
CGKAFNSRSYLIAHQRSHTREKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75437	0.344	0.378	4.009E-57	659	0.470	0.530	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
2	AFDB:Q06732	0.467	0.448	1.107E-56	778	0.396	0.378	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
3	AFDB:P17038	0.265	0.248	1.300E-56	809	0.485	0.445	P17038.pdb.gz	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	AFDB:Q05481	0.330	0.227	1.447E-56	1191	0.474	0.296	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
5	AFDB:A6NNF4	0.420	0.422	4.949E-56	738	0.479	0.482	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
6	AFDB:Q14587	0.445	0.358	1.296E-55	947	0.408	0.320	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
7	AFDB:Q6ECI4	0.432	0.446	1.367E-55	717	0.429	0.445	Q6ECI4.pdb.gz	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
8	AFDB:Q03923	0.441	0.533	1.442E-55	595	0.452	0.565	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
9	AFDB:Q02386	0.457	0.494	2.461E-55	682	0.421	0.459	Q02386.pdb.gz	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
10	AFDB:P35789	0.425	0.500	3.048E-55	620	0.432	0.518	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
11	PDB:3w5kB	0.071	0.287	6.554E-4	110	0.057	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6gejS	0.045	0.124	8.478E-1	208	0.044	0.159	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:6ff4t	0.037	0.113	2.220	172	0.039	0.169	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	PDB:7ena4	0.059	0.081	2.342	457	0.052	0.085	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
15	PDB:7uhyA	0.043	0.042	2.342	771	0.032	0.031	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:6lsr0	0.043	0.114	2.749	190	0.030	0.116	6lsr0.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
17	PDB:6t9iK	0.054	0.099	2.749	279	0.055	0.147	6t9iK.pdb.gz
18	PDB:7dvqM	0.034	0.100	3.405	191	0.039	0.152	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:5gm6a	0.027	0.107	3.789	123	0.036	0.220	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:1e7dA	0.051	0.142	3.997	157	0.028	0.134	1e7dA.pdb.gz	Conformational Flexibility in T4 Endonuclease Vii Revealed by Crystallography: Implications for Substrate Binding and Cleavage

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	0.0	567	616	0.432	0.521	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	0.0	594	659	0.460	0.519	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	0.0	653	809	0.507	0.466	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P51523	0.0	578	738	0.440	0.443	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
5	Q02386	0.0	546	682	0.435	0.474	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
6	Q05481	0.0	557	1191	0.420	0.262	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
7	Q14587	0.0	551	947	0.447	0.351	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
8	Q3V1X2	0.0	553	888	0.474	0.396	Q3V1X2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
9	Q5DTF8	0.0	551	919	0.474	0.383	Q5DTF8_MOUSE MKIAA4236 protein (Fragment) OS=Mus musculus OX=10090 GN=Zfp748 PE=2 SV=1
10	Q6ECI4	0.0	592	717	0.443	0.459	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
11	Q7TMN8	0.0	548	578	0.390	0.502	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
12	Q7TPL6	0.0	552	888	0.474	0.396	Q7TPL6_MOUSE Zinc finger protein 748 OS=Mus musculus OX=10090 GN=Zfp748 PE=1 SV=1
13	Q8BLA2	0.0	547	578	0.389	0.500	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
14	Q8IYB9	0.0	560	648	0.431	0.494	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
15	Q8TAQ5	0.0	550	688	0.402	0.435	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
16	Q8WXB4	0.0	541	792	0.429	0.403	ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens OX=9606 GN=ZNF606 PE=2 SV=1
17	Q9P2J8	0.0	606	865	0.472	0.406	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
18	Q9UII5	0.0	555	783	0.447	0.424	ZN107_HUMAN Zinc finger protein 107 OS=Homo sapiens OX=9606 GN=ZNF107 PE=1 SV=1
19	Q76KX8	5.93e-179	529	674	0.427	0.470	ZN534_HUMAN Zinc finger protein 534 OS=Homo sapiens OX=9606 GN=ZNF534 PE=1 SV=1
20	P35789	2.25e-177	523	620	0.402	0.482	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	1.2e+02	14.4	TFIIH C1-like domain
2	PF12552 DUF3741	2.7	19.3	Protein of unknown function (DUF3741)
3	PF01352 KRAB	1.6e-21	87.0	KRAB box
4	PF01286 XPA_N	0.00013	33.2	XPA protein N-terminal
5	PF00096 zf-C2H2	6.5e-69	235.9	Zinc finger, C2H2 type
6	PF13894 zf-C2H2_4	6.9e-35	127.7	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	2e-23	93.1	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	2.2e-08	45.4	Zinc-finger double-stranded RNA-binding
9	PF13465 zf-H2C2_2	4.5e-95	319.5	Zinc-finger double domain
10	PF12874 zf-met	2.2e-05	35.9	Zinc-finger of C2H2 type
11	PF18439 zf_UBZ	2.7e+02	12.6	Ubiquitin-Binding Zinc Finger
12	PF09723 Zn-ribbon_8	0.00032	32.1	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300870

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379144	0.680	Trinucleotide repeat-containing gene 6A protein
2	9606.ENSP00000358242	0.653	Arginine/serine-rich protein PNISR
3	9606.ENSP00000328228	0.627	Cell division cycle-associated protein 2
4	9606.ENSP00000262510	0.537	Protein NLRC5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0043565	0.505	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0019222	0.996	regulation of metabolic process
GO:0080090	0.994	regulation of primary metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0031323	0.994	regulation of cellular metabolic process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0010556	0.980	regulation of macromolecule biosynthetic process
GO:0031326	0.980	regulation of cellular biosynthetic process
GO:0010468	0.979	regulation of gene expression
GO:0051252	0.979	regulation of RNA metabolic process
GO:0006355	0.911	regulation of DNA-templated transcription
GO:0048523	0.905	negative regulation of cellular process
GO:0009892	0.894	negative regulation of metabolic process
GO:0009890	0.879	negative regulation of biosynthetic process
GO:0031324	0.865	negative regulation of cellular metabolic process
GO:0051172	0.862	negative regulation of nitrogen compound metabolic process
GO:0010605	0.857	negative regulation of macromolecule metabolic process
GO:0010558	0.847	negative regulation of macromolecule biosynthetic process
GO:0031327	0.846	negative regulation of cellular biosynthetic process
GO:1902679	0.703	negative regulation of RNA biosynthetic process
GO:1903507	0.610	negative regulation of nucleic acid-templated transcription
GO:0045892	0.553	negative regulation of DNA-templated transcription
GO:0009987	0.394	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.980	nucleoplasm
GO:0005737	0.815	cytoplasm
GO:0043232	0.655	intracellular non-membrane-bounded organelle
GO:0005829	0.317	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]