StarFunc result for job id Q14590

User Input

>input (738 residues)
MTKFQEAVTFKDVAVAFTEEELGLLDSAQRKLYRDVMLENFRNLVSVGHQSFKPDMISQL
EREEKLWMKELQTQRGKHSGDRNQNEMATLHKAGLRCFSLGELSCWQIKRHIASKLARSQ
DSMINIEGKSSQFPKHHDSPCQVGAGESIQASVDDNCLVNHIGDHSSIIENQEFPTGKVP
NSWSKIYLNETQNYQRSCKQTQMKNKLCIFAPYVDIFSCISHHHDDNIVHKRDKVHSNSD
CGKDTLKVSPLTQRSIHTGQKTYQGNECEEAFNDSSSLELHKQVHLGKKSPACSTHEKDT
SYSSGIPVQQSVRTGKKRYWCHECGKGFSQSSNLQTHQRVHTGEKPYTCHECGKSFNQSS
HLYAHLPIHTGEKPYRCDSCGKGFSRSTDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQA
HERIHTGEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYKCDECGKCFSLSFNLHSHQRV
HTGEKPYKCEECGKGFSSASSFQSHQRVHTGEKPFRCNVCGKGFSQSSYFQAHQRVHTGE
KPYKCEVCGKRFNWSLNLHNHQRVHTGEKPYKCEECGKGFSQASNLQAHQSVHTGEKPFK
CDACQKRFSQASHLQAHQRVHTGEKPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCEEC
GKEFSWSAGLSAHQRVHTGEKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICDVCCKGF
SQRSHLIYHQRVHTGGNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q86WZ6	0.467	0.433	3.120E-69	799	0.550	0.508	Q86WZ6.pdb.gz	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
2	AFDB:Q62788	0.395	0.392	5.372E-67	744	0.560	0.555	Q62788.pdb.gz	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
3	AFDB:Q02386	0.498	0.536	2.120E-63	682	0.518	0.560	Q02386.pdb.gz	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
4	AFDB:Q06732	0.531	0.506	1.561E-61	778	0.411	0.389	Q06732.pdb.gz	ZN33B_HUMAN Zinc finger protein 33B OS=Homo sapiens OX=9606 GN=ZNF33B PE=1 SV=2
5	AFDB:P51814	0.427	0.388	2.322E-57	821	0.415	0.373	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
6	AFDB:A0A024R4S7	0.453	0.426	4.630E-57	792	0.412	0.384	A0A024R4S7.pdb.gz
7	AFDB:Q8TF45	0.372	0.402	3.129E-56	676	0.383	0.419	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
8	AFDB:P51523	0.508	0.508	4.944E-55	738	0.411	0.411	P51523.pdb.gz	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
9	AFDB:Q9HCZ1	0.343	0.370	1.429E-54	680	0.364	0.396	Q9HCZ1.pdb.gz	ZN334_HUMAN Zinc finger protein 334 OS=Homo sapiens OX=9606 GN=ZNF334 PE=1 SV=2
10	AFDB:A0A024R4I3	0.464	0.517	2.073E-54	652	0.401	0.454	A0A024R4I3.pdb.gz
11	PDB:3w5kB	0.071	0.265	1.039E-3	110	0.054	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5c8dE	0.071	0.118	1.146	280	0.039	0.104	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
13	PDB:5gm6a	0.028	0.116	1.495	123	0.034	0.203	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
14	PDB:7ena4	0.062	0.086	1.662	457	0.064	0.103	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
15	PDB:6gejS	0.047	0.106	1.753	208	0.041	0.144	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
16	PDB:7ad8D	0.034	0.067	1.753	280	0.024	0.064	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
17	PDB:5dkaA	0.048	0.230	1.949	96	0.030	0.229	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
18	PDB:6vp9B	0.078	0.068	2.542	914	0.065	0.053	6vp9B.pdb.gz	Molecular basis for N-terminal alpha-synuclein acetylation by human NatB.
19	PDB:2p01A	0.071	0.116	2.680	323	0.065	0.149	2p01A.pdb.gz
20	PDB:7tveG	0.048	0.097	2.680	307	0.050	0.121	7tveG.pdb.gz	Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I6G8Y2	587	723	0.416	0.425	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
2	A8K8Y5	552	707	0.366	0.382	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
3	G3V9G6	588	740	0.416	0.415	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
4	P15620	550	580	0.386	0.491	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
5	P17038	548	809	0.379	0.346	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
6	P51523	582	738	0.450	0.450	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
7	P52742	562	658	0.444	0.498	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
8	Q02386	560	682	0.409	0.443	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
9	Q03923	534	595	0.417	0.518	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
10	Q05481	556	1191	0.379	0.235	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
11	Q14587	557	947	0.436	0.340	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
12	Q5MCW4	542	686	0.370	0.398	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
13	Q62788	588	744	0.416	0.413	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
14	Q7TMN8	541	578	0.375	0.479	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
15	Q86WZ6	758	799	0.568	0.524	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
16	Q8BLA2	540	578	0.374	0.478	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
17	Q8TAQ5	543	688	0.373	0.400	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
18	Q8WXB4	542	792	0.420	0.391	ZN606_HUMAN Zinc finger protein 606 OS=Homo sapiens OX=9606 GN=ZNF606 PE=2 SV=1
19	Q99K53	593	700	0.427	0.450	Q99K53_MOUSE Zfp111 protein OS=Mus musculus OX=10090 GN=Zfp111 PE=2 SV=1
20	Q9NZL3	552	707	0.366	0.382	ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens OX=9606 GN=ZNF224 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	73	15.0	TFIIH C1-like domain
2	PF19148 DUF5830	53	15.2	Family of unknown function (DUF5830)
3	PF01352 KRAB	6.3e-20	81.8	KRAB box
4	PF01286 XPA_N	0.23	22.9	XPA protein N-terminal
5	PF00096 zf-C2H2	3.9e-77	261.8	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	53	15.0	zinc-finger C2H2-type
7	PF13894 zf-C2H2_4	1.9e-40	145.0	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	0.00016	32.9	C2H2-type zinc finger
9	PF12171 zf-C2H2_jaz	2.7e-16	70.6	Zinc-finger double-stranded RNA-binding
10	PF13465 zf-H2C2_2	1.9e-109	365.0	Zinc-finger double domain
11	PF12874 zf-met	0.11	24.2	Zinc-finger of C2H2 type
12	PF13451 zf-trcl	2.4e+02	13.0	Probable zinc-ribbon domain
13	PF18439 zf_UBZ	1.5e-07	42.2	Ubiquitin-Binding Zinc Finger
14	PF17032 zinc_ribbon_15	3.1	19.9	zinc-ribbon family
15	PF09723 Zn-ribbon_8	2e-07	42.3	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000291182

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307746	0.588	Zinc finger protein 608
2	9606.ENSP00000237937	0.572	AN1-type zinc finger protein 5
3	9606.ENSP00000262887	0.547	DNA repair protein XRCC1
4	9606.ENSP00000479904	0.507	Zinc finger MYM-type protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.998	regulation of macromolecule metabolic process
GO:0019219	0.997	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.989	regulation of RNA metabolic process
GO:0010468	0.987	regulation of gene expression
GO:0010556	0.987	regulation of macromolecule biosynthetic process
GO:0006355	0.984	regulation of DNA-templated transcription
GO:0048519	0.977	negative regulation of biological process
GO:0009892	0.969	negative regulation of metabolic process
GO:0048523	0.967	negative regulation of cellular process
GO:0051172	0.948	negative regulation of nitrogen compound metabolic process
GO:0010605	0.874	negative regulation of macromolecule metabolic process
GO:0031324	0.846	negative regulation of cellular metabolic process
GO:0045892	0.763	negative regulation of DNA-templated transcription
GO:0048518	0.749	positive regulation of biological process
GO:0048522	0.683	positive regulation of cellular process
GO:0009893	0.467	positive regulation of metabolic process
GO:0051173	0.446	positive regulation of nitrogen compound metabolic process
GO:0010604	0.446	positive regulation of macromolecule metabolic process
GO:0031325	0.433	positive regulation of cellular metabolic process
GO:0006357	0.413	regulation of transcription by RNA polymerase II
GO:0045935	0.412	positive regulation of nucleobase-containing compound metabolic process
GO:0031328	0.339	positive regulation of cellular biosynthetic process
GO:0051254	0.337	positive regulation of RNA metabolic process
GO:0009987	0.331	cellular process
GO:0045893	0.321	positive regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.980	nuclear lumen
GO:0005654	0.966	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]