StarFunc result for job id Q14593

User Input

>input (569 residues)
MSSAPRGPPSVAPLPAGIGRSTAKTPGLPGSLEMGPLTFRDVAIEFSLEEWQCLDTSQQN
LYRNVMLDNYRNLVFLGIAVSKPDLITCLEQGKEPCNMKRHAMVAKPPVVCSHFAQDLWP
KQGLKDSFQKVILRRYGKYGHENLQLRKGCKSADEHKVHKRGYNGLNQCLTTTQSKIFQC
DKYVKVLHKFSNSNIHKKRQTGKKPFKCKECGKSCCILSQLTQHKKTATRVNFYKCKTCG
KAFNQFSNLTKHKIIHPEVNPYKCEECGKAFNQSLTLTKHKKIHTEEKPYKCEDCGKVFS
VFSVLTKHKIIHTGTKPYNCEECGKGFSIFSTLTKHKIIHTGEKPYKCNECGKAFNWSST
LTKHKRIHTGEKPYKCEECGKAFNQSSTLTRHKIVHTGEKPYKCEECGKAFKRSTTLTKH
KRIYTKEKPYKCEECGKAFSVFSTLTKHKIIHTGAKPYKCEECGSAFRAFSTLTEHKRVH
TGEKPYKCNECGKAFNWSSTLTKHKRIHTGEKPYKCEECGKAFNRSSNLTRHKKIHTGEK
PYKPKRCDSAFDNTPNFSRHKRNHMGEKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14593	1.000	1.000	8.856E-92	569	1.000	1.000	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
2	AFDB:Q03923	0.435	0.418	2.123E-65	595	0.701	0.671	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
3	AFDB:A6NNF4	0.441	0.354	2.101E-64	738	0.677	0.522	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
4	AFDB:Q05481	0.449	0.248	2.101E-64	1191	0.680	0.325	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
5	AFDB:Q9H8G1	0.437	0.436	3.217E-63	570	0.680	0.679	Q9H8G1.pdb.gz	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
6	AFDB:P35789	0.311	0.287	6.907E-63	620	0.678	0.623	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
7	AFDB:Q8TD23	0.454	0.455	9.074E-63	568	0.680	0.681	Q8TD23.pdb.gz	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
8	AFDB:Q96JC4	0.455	0.490	1.316E-61	524	0.640	0.695	Q96JC4.pdb.gz	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
9	AFDB:Q03936	0.394	0.384	4.875E-61	586	0.694	0.674	Q03936.pdb.gz	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
10	AFDB:O75437	0.407	0.360	1.806E-60	659	0.692	0.598	O75437.pdb.gz	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
11	PDB:3w5kB	0.092	0.305	5.388E-4	110	0.069	0.355	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7pntS	0.056	0.180	2.158	136	0.026	0.110	7pntS.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
13	PDB:7mq9SI	0.078	0.056	2.542	844	0.039	0.026	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7ajuCK	0.044	0.083	3.339	222	0.063	0.162	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7mqaSI	0.080	0.060	3.527	803	0.035	0.025	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6gejS	0.056	0.115	4.387	208	0.060	0.163	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
17	PDB:7kpxC	0.078	0.049	4.633	1352	0.083	0.035	7kpxC.pdb.gz
18	PDB:5gm6a	0.042	0.130	4.893	123	0.054	0.252	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
19	PDB:6zx9C	0.062	0.097	4.893	257	0.021	0.047	6zx9C.pdb.gz	Structural insights into Cullin4-RING ubiquitin ligase remodelling by Vpr from simian immunodeficiency viruses.
20	PDB:5mpsK	0.049	0.142	5.167	187	0.042	0.128	5mpsK.pdb.gz	Structure of a spliceosome remodelled for exon ligation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	758	616	0.677	0.625	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	773	659	0.707	0.610	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	713	809	0.659	0.464	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	745	620	0.661	0.606	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	781	595	0.701	0.671	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	778	586	0.694	0.674	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q05481	736	1191	0.680	0.325	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	Q14593	1169	569	1.000	1.000	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	Q15928	635	474	0.548	0.658	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	Q2NKJ9	758	569	0.678	0.678	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
11	Q49A12	644	536	0.587	0.623	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
12	Q5JVG8	587	444	0.518	0.664	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
13	Q6ZR52	541	646	0.511	0.450	ZN493_HUMAN Zinc finger protein 493 OS=Homo sapiens OX=9606 GN=ZNF493 PE=1 SV=3
14	Q8IW36	583	515	0.538	0.594	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
15	Q8IYB9	676	648	0.620	0.545	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
16	Q8IYN0	717	542	0.645	0.677	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
17	Q8IYX0	559	411	0.506	0.701	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
18	Q8TD23	751	568	0.668	0.669	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
19	Q96H40	624	463	0.548	0.674	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
20	Q96JC4	731	524	0.640	0.695	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	1.1	20.9	BolA-like protein
2	PF06397 Desulfoferrod_N	1.5	19.8	Desulfoferrodoxin, N-terminal domain
3	PF03604 DNA_RNApol_7kD	41	15.3	DNA directed RNA polymerase, 7 kDa subunit
4	PF19561 DUF6083	2.9	19.0	Family of unknown function (DUF6083)
5	PF14432 DYW_deaminase	7.9e+02	11.3	DYW family of nucleic acid deaminases
6	PF09237 GAGA	4.2e+02	12.4	GAGA factor
7	PF00982 Glyco_transf_20	1.4e+02	12.5	Glycosyltransferase family 20
8	PF01352 KRAB	3.7e-19	79.4	KRAB box
9	PF01096 TFIIS_C	66	14.8	Transcription factor S-II (TFIIS)
10	PF01286 XPA_N	3.8e-09	47.7	XPA protein N-terminal
11	PF01428 zf-AN1	52	15.4	AN1-like Zinc finger
12	PF00096 zf-C2H2	8.3e-57	197.7	Zinc finger, C2H2 type
13	PF16622 zf-C2H2_11	1.3e-15	68.1	zinc-finger C2H2-type
14	PF13894 zf-C2H2_4	2.6e-28	107.2	C2H2-type zinc finger
15	PF13912 zf-C2H2_6	1.4e-20	84.0	C2H2-type zinc finger
16	PF15909 zf-C2H2_8	0.29	22.8	C2H2-type zinc ribbon
17	PF12171 zf-C2H2_jaz	0.0041	28.6	Zinc-finger double-stranded RNA-binding
18	PF13465 zf-H2C2_2	4e-88	297.5	Zinc-finger double domain
19	PF13451 zf-trcl	1.6e+02	13.6	Probable zinc-ribbon domain
20	PF18439 zf_UBZ	4.7e-09	47.1	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418719

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000436212	0.667	Zinc finger protein 707

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0019219	0.992	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0051172	0.976	negative regulation of nitrogen compound metabolic process
GO:0051253	0.968	negative regulation of RNA metabolic process
GO:0010468	0.966	regulation of gene expression
GO:0010558	0.965	negative regulation of macromolecule biosynthetic process
GO:1903506	0.955	regulation of nucleic acid-templated transcription
GO:0006355	0.954	regulation of DNA-templated transcription
GO:0045892	0.942	negative regulation of DNA-templated transcription
GO:0009987	0.608	cellular process
GO:0006357	0.321	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.941	nuclear lumen
GO:0005654	0.897	nucleoplasm
GO:0005737	0.687	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]