StarFunc result for job id Q14596

User Input

>input (966 residues)
MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINS
QGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRV
LGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEK
LVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNIC
EDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKA
EKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLP
LQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLT
LASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDP
FPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKN
VASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIE
KPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLD
AAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDE
VQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGVEAGQEPAEAG
ERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPV
TIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKAL
FAGPPVTAQPIISEDQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLNNND
WYSQRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1V3	0.181	0.181	0.000	966	1.000	1.000	A0A024R1V3.pdb.gz
2	AFDB:P97432	0.233	0.228	0.000	988	0.849	0.830	P97432.pdb.gz	NBR1_MOUSE Next to BRCA1 gene 1 protein OS=Mus musculus OX=10090 GN=Nbr1 PE=1 SV=1
3	PDB:7vqoA	0.093	0.077	1.669E-9	1180	0.035	0.029	7vqoA.pdb.gz	Structural mechanism of protein recognition by the FW domain of autophagy receptor Nbr1
4	AFDB:F4K1J4	0.056	0.041	3.257E-5	1423	0.130	0.089	F4K1J4.pdb.gz	ATXR7_ARATH Histone-lysine N-methyltransferase ATXR7 OS=Arabidopsis thaliana OX=3702 GN=ATXR7 PE=2 SV=1
5	PDB:5kwyC	0.093	0.528	2.043E-4	133	0.018	0.128	5kwyC.pdb.gz	Clues to the mechanism of cholesterol transfer from the structure of NPC1 middle lumenal domain bound to NPC2.
6	PDB:4g1eA	0.090	0.090	2.289E-4	964	0.018	0.018	4g1eA.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
7	PDB:2hkaB	0.096	0.588	3.220E-4	130	0.017	0.123	2hkaB.pdb.gz	Structural Basis of Sterol Binding by NPC2, a Lysosomal Protein Deficient in Niemann-Pick Type C2 Disease
8	AFDB:Q5A849	0.043	0.038	3.549E-4	1225	0.111	0.087	Q5A849.pdb.gz	HYR4_CANAL Hyphally regulated cell wall protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HYR4 PE=1 SV=1
9	AFDB:Q1JQ46	0.077	0.122	4.716E-4	573	0.080	0.134	Q1JQ46.pdb.gz
10	PDB:2ag2A	0.087	0.374	4.794E-4	164	0.026	0.152	2ag2A.pdb.gz	Crystal Structure Analysis of Phosphatidylcholine-GM2-Activator Product Complexes: Evidence for Hydrolase Activity.
11	AFDB:Q381X2	0.068	0.050	6.634E-4	1408	0.071	0.049	Q381X2.pdb.gz	Q381X2_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6260 PE=4 SV=1
12	PDB:2agcA	0.087	0.390	1.004E-3	162	0.023	0.136	2agcA.pdb.gz
13	PDB:7uslA	0.087	0.097	1.495E-3	856	0.017	0.019	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
14	PDB:7tvzE	0.095	0.135	1.987E-3	665	0.012	0.018	7tvzE.pdb.gz	Structure, dynamics and assembly of the ankyrin complex on human red blood cell membrane.
15	PDB:5ir3A	0.061	0.312	2.103E-3	111	0.019	0.162	5ir3A.pdb.gz
16	AFDB:Q0E9F2	0.071	0.048	2.190E-3	1542	0.080	0.050	Q0E9F2.pdb.gz	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
17	PDB:6xt9A	0.081	0.128	2.226E-3	567	0.028	0.048	6xt9A.pdb.gz
18	AFDB:Q5U0U1	0.057	0.045	6.829E-3	1267	0.129	0.099	Q5U0U1.pdb.gz	Q5U0U1_DROME AT17006p OS=Drosophila melanogaster OX=7227 GN=salr PE=2 SV=1
19	AFDB:Q9JIR0	0.052	0.034	6.829E-3	1847	0.161	0.084	Q9JIR0.pdb.gz	RIMB1_RAT Peripheral-type benzodiazepine receptor-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Tspoap1 PE=1 SV=2
20	AFDB:E9Q8E3	0.063	0.066	8.574E-3	909	0.081	0.086	E9Q8E3.pdb.gz	E9Q8E3_MOUSE ABI family member 3 binding protein OS=Mus musculus OX=10090 GN=Abi3bp PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7Z5R6	0.0	1701	837	0.862	0.995	B7Z5R6_HUMAN NBR1 autophagy cargo receptor OS=Homo sapiens OX=9606 GN=NBR1 PE=1 SV=1
2	P97432	0.0	1597	988	0.849	0.830	NBR1_MOUSE Next to BRCA1 gene 1 protein OS=Mus musculus OX=10090 GN=Nbr1 PE=1 SV=1
3	Q14596	0.0	1992	966	1.000	1.000	NBR1_HUMAN Next to BRCA1 gene 1 protein OS=Homo sapiens OX=9606 GN=NBR1 PE=1 SV=3
4	M1BJF6	2.96e-15	83.2	862	0.049	0.055	JOKA2_SOLTU Protein JOKA2 OS=Solanum tuberosum OX=4113 GN=JOKA2 PE=1 SV=1
5	Q55CE3	2.91e-13	76.3	646	0.038	0.057	Q55CE3_DICDI ZZ-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0270098 PE=4 SV=1
6	Q9SB64	1.90e-12	73.6	704	0.046	0.062	NBR1_ARATH Protein NBR1 homolog OS=Arabidopsis thaliana OX=3702 GN=NBR1 PE=1 SV=1
7	F7GSB8	2.93e-07	56.6	440	0.026	0.057	F7GSB8_MACMU Sequestosome 1 OS=Macaca mulatta OX=9544 GN=SQSTM1 PE=4 SV=3
8	Q13501	2.93e-07	56.6	440	0.026	0.057	SQSTM_HUMAN Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1 PE=1 SV=1
9	Q9H6K1	6.12e-07	54.7	298	0.033	0.107	ILRUN_HUMAN Protein ILRUN OS=Homo sapiens OX=9606 GN=ILRUN PE=1 SV=2
10	Q5TH58	1.19e-06	52.8	224	0.032	0.138	Q5TH58_HUMAN Inflammation and lipid regulator with UBA-like and NBR1-like domains OS=Homo sapiens OX=9606 GN=ILRUN PE=1 SV=1
11	Q64337	1.44e-06	54.3	442	0.029	0.063	SQSTM_MOUSE Sequestosome-1 OS=Mus musculus OX=10090 GN=Sqstm1 PE=1 SV=1
12	O08623	6.71e-06	52.0	439	0.023	0.050	SQSTM_RAT Sequestosome-1 OS=Rattus norvegicus OX=10116 GN=Sqstm1 PE=1 SV=1
13	Q9N3Z0	1.55e-05	49.7	242	0.025	0.099	Q9N3Z0_CAEEL ZZ-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sqst-2 PE=1 SV=2
14	Q17746	4.06e-05	49.7	498	0.019	0.036	Q17746_CAEEL ZZ-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C06G3.6 PE=1 SV=1
15	F1Q5Z8	2.48e-04	47.0	452	0.019	0.040	F1Q5Z8_DANRE Sequestosome-1 OS=Danio rerio OX=7955 GN=p62 PE=2 SV=1
16	Q8RWY4	0.001	45.1	841	0.024	0.027	NLP6_ARATH Protein NLP6 OS=Arabidopsis thaliana OX=3702 GN=NLP6 PE=2 SV=2
17	Q9P792	0.002	44.3	397	0.025	0.060	YN8B_SCHPO ZZ-type zinc finger-containing protein P35G2.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.11c PE=1 SV=1
18	O43149	0.030	40.8	2961	0.016	0.005	ZZEF1_HUMAN Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZZEF1 PE=1 SV=6
19	Q22436	0.042	40.0	693	0.014	0.020	Q22436_CAEEL ZZ-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=sqst-1 PE=1 SV=2
20	Q84TH9	0.042	40.4	959	0.021	0.021	NLP7_ARATH Protein NLP7 OS=Arabidopsis thaliana OX=3702 GN=NLP7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03107 C1_2	1.7e+02	13.9	C1 domain
2	PF09026 CENP-B_dimeris	4.2e+02	12.8	Centromere protein B dimerisation domain
3	PF18210 Knl1_RWD_C	96	14.6	Knl1 RWD C-terminal domain
4	PF16158 N_BRCA1_IG	5.6e-27	105.7	Ig-like domain from next to BRCA1 gene
5	PF00564 PB1	1.6e-09	48.9	PB1 domain
6	PF08209 Sgf11	4.5e+02	11.8	Sgf11 (transcriptional regulation protein)
7	PF00569 ZZ	0.013	26.6	Zinc finger, ZZ type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411250

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000037243	0.996	Gamma-aminobutyric acid receptor-associated protein-like 2
2	9606.ENSP00000266458	0.993	Gamma-aminobutyric acid receptor-associated protein-like 1
3	9606.ENSP00000306866	0.992	Gamma-aminobutyric acid receptor-associated protein
4	9606.ENSP00000268607	0.991	Microtubule-associated proteins 1A/1B light chain 3B
5	9606.ENSP00000467141	0.991	Titin
6	9606.ENSP00000441543	0.982	Polyubiquitin-C
7	9606.ENSP00000374455	0.977	Sequestosome-1
8	9606.ENSP00000363970	0.953	Microtubule-associated proteins 1A/1B light chain 3A
9	9606.ENSP00000272317	0.951	Ubiquitin-40S ribosomal protein S27a
10	9606.ENSP00000360540	0.943	Centrosomal protein of 55 kDa
11	9606.ENSP00000358072	0.933	Autophagy protein 5
12	9606.ENSP00000391601	0.930	Peroxisomal targeting signal 1 receptor
13	9606.ENSP00000304697	0.914	Polyubiquitin-B
14	9606.ENSP00000263734	0.903	Endothelial PAS domain-containing protein 1
15	9606.ENSP00000349785	0.900	Microtubule-associated proteins 1A/1B light chain 3C
16	9606.ENSP00000346437	0.883	Ubiquitin-like modifier-activating enzyme ATG7
17	9606.ENSP00000355231	0.883	Beclin-1
18	9606.ENSP00000283290	0.875	Ubiquitin-like-conjugating enzyme ATG3
19	9606.ENSP00000398523	0.874	Calcium-binding and coiled-coil domain-containing protein 2
20	9606.ENSP00000363390	0.869	E3 ubiquitin-protein ligase TRIM63

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.995	protein kinase binding
GO:0051019	0.992	mitogen-activated protein kinase binding
GO:0032182	0.972	ubiquitin-like protein binding
GO:0043130	0.839	ubiquitin binding
GO:0042802	0.372	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0016236	0.985	macroautophagy
GO:0065007	0.910	biological regulation
GO:0050794	0.902	regulation of cellular process
GO:0048519	0.651	negative regulation of biological process
GO:0048523	0.582	negative regulation of cellular process
GO:0048583	0.567	regulation of response to stimulus
GO:0071704	0.506	organic substance metabolic process
GO:0071840	0.434	cellular component organization or biogenesis
GO:0048518	0.430	positive regulation of biological process
GO:0023051	0.404	regulation of signaling
GO:0048522	0.396	positive regulation of cellular process
GO:0016043	0.387	cellular component organization
GO:0044238	0.367	primary metabolic process
GO:0050896	0.349	response to stimulus
GO:0006807	0.346	nitrogen compound metabolic process
GO:0009966	0.341	regulation of signal transduction
GO:0043170	0.315	macromolecule metabolic process
GO:1901564	0.309	organonitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0016020	0.986	membrane
GO:0005829	0.976	cytosol
GO:0016604	0.966	nuclear body
GO:0031090	0.936	organelle membrane
GO:0098588	0.864	bounding membrane of organelle
GO:0032991	0.841	protein-containing complex
GO:0005739	0.789	mitochondrion
GO:0005777	0.635	peroxisome
GO:0005778	0.461	peroxisomal membrane
GO:0012505	0.417	endomembrane system
GO:0031982	0.380	vesicle
GO:0043232	0.329	intracellular non-membrane-bounded organelle
GO:0031410	0.317	cytoplasmic vesicle
GO:0005768	0.313	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]