StarFunc result for job id Q14623

User Input

>input (411 residues)
MSPARLRPRLHFCLVLLLLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKT
LGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMN
QWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSPTF
SDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQP
GQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTKHGTLVVEDVVASCFAAVADHHLAQLA
FWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1LP42	0.842	0.842	2.570E-82	411	0.949	0.949	F1LP42.pdb.gz	F1LP42_RAT Hedgehog protein OS=Rattus norvegicus OX=10116 GN=Ihh PE=3 SV=2
2	AFDB:Q98938	0.724	0.728	5.052E-71	408	0.776	0.782	Q98938.pdb.gz	IHH_CHICK Indian hedgehog protein OS=Gallus gallus OX=9031 GN=IHH PE=2 SV=1
3	AFDB:Q92008	0.780	0.768	1.368E-60	418	0.620	0.610	Q92008.pdb.gz	SHH_DANRE Sonic hedgehog protein OS=Danio rerio OX=7955 GN=shha PE=1 SV=1
4	AFDB:F1P3J4	0.830	0.804	2.181E-60	425	0.623	0.602	F1P3J4.pdb.gz
5	AFDB:Q90419	0.677	0.670	3.908E-60	416	0.577	0.570	Q90419.pdb.gz	TWHH_DANRE Tiggy-winkle hedgehog protein OS=Danio rerio OX=7955 GN=shhb PE=1 SV=1
6	AFDB:Q98862	0.830	0.828	5.877E-60	412	0.613	0.612	Q98862.pdb.gz	IHH_DANRE Indian hedgehog B protein OS=Danio rerio OX=7955 GN=ihhb PE=2 SV=1
7	AFDB:A3KNS3	0.693	0.690	2.837E-59	413	0.606	0.603	A3KNS3.pdb.gz	A3KNS3_DANRE Hedgehog protein OS=Danio rerio OX=7955 GN=hha PE=2 SV=1
8	AFDB:Q62226	0.782	0.740	4.523E-59	437	0.633	0.595	Q62226.pdb.gz	SHH_MOUSE Sonic hedgehog protein OS=Mus musculus OX=10090 GN=Shh PE=1 SV=2
9	AFDB:Q15465	0.868	0.777	5.883E-58	462	0.640	0.569	Q15465.pdb.gz	SHH_HUMAN Sonic hedgehog protein OS=Homo sapiens OX=9606 GN=SHH PE=1 SV=1
10	AFDB:G3V7Y0	0.499	0.516	3.586E-57	396	0.555	0.576	G3V7Y0.pdb.gz	G3V7Y0_RAT Hedgehog protein OS=Rattus norvegicus OX=10116 GN=Dhh PE=3 SV=1
11	PDB:6td6B	0.337	0.971	2.593E-18	140	0.226	0.664	6td6B.pdb.gz
12	PDB:6rpqA	0.293	0.468	7.442E-8	249	0.058	0.096	6rpqA.pdb.gz
13	PDB:5fb5B	0.074	0.060	1.689E-1	576	0.073	0.052	5fb5B.pdb.gz
14	PDB:1u10C	0.186	0.300	2.260E-1	241	0.056	0.095	1u10C.pdb.gz	Peptidoglycan amidase MepA is a LAS metallopeptidase
15	PDB:4bbjA	0.077	0.056	2.854E-1	664	0.051	0.032	4bbjA.pdb.gz	Copper-Transporting P-Type Atpases Use a Unique Ion-Release Pathway
16	PDB:2cseA	0.073	0.053	3.025E-1	641	0.044	0.028	2cseA.pdb.gz
17	PDB:2kfwA	0.067	0.123	4.550E-1	196	0.054	0.112	2kfwA.pdb.gz
18	PDB:3j09A	0.069	0.043	6.843E-1	723	0.039	0.022	3j09A.pdb.gz
19	PDB:7y4sA	0.076	0.086	6.843E-1	343	0.061	0.073	7y4sA.pdb.gz
20	PDB:6s1kA	0.138	0.145	7.689E-1	383	0.054	0.057	6s1kA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LP42	0.0	746	411	0.908	0.908	F1LP42_RAT Hedgehog protein OS=Rattus norvegicus OX=10116 GN=Ihh PE=3 SV=2
2	P97812	0.0	778	411	0.951	0.951	IHH_MOUSE Indian hedgehog protein OS=Mus musculus OX=10090 GN=Ihh PE=1 SV=2
3	Q14623	0.0	840	411	1.000	1.000	IHH_HUMAN Indian hedgehog protein OS=Homo sapiens OX=9606 GN=IHH PE=1 SV=4
4	Q98938	0.0	626	408	0.757	0.762	IHH_CHICK Indian hedgehog protein OS=Gallus gallus OX=9031 GN=IHH PE=2 SV=1
5	Q91035	6.82e-174	494	425	0.623	0.602	SHH_CHICK Sonic hedgehog protein OS=Gallus gallus OX=9031 GN=SHH PE=1 SV=1
6	Q92008	1.42e-171	488	418	0.574	0.565	SHH_DANRE Sonic hedgehog protein OS=Danio rerio OX=7955 GN=shha PE=1 SV=1
7	Q90419	1.34e-169	483	416	0.584	0.577	TWHH_DANRE Tiggy-winkle hedgehog protein OS=Danio rerio OX=7955 GN=shhb PE=1 SV=1
8	Q62226	2.10e-169	483	437	0.635	0.597	SHH_MOUSE Sonic hedgehog protein OS=Mus musculus OX=10090 GN=Shh PE=1 SV=2
9	A3KNS3	1.12e-168	480	413	0.613	0.610	A3KNS3_DANRE Hedgehog protein OS=Danio rerio OX=7955 GN=hha PE=2 SV=1
10	Q63673	1.16e-163	468	437	0.616	0.579	SHH_RAT Sonic hedgehog protein OS=Rattus norvegicus OX=10116 GN=Shh PE=1 SV=1
11	Q98862	1.54e-162	464	412	0.613	0.612	IHH_DANRE Indian hedgehog B protein OS=Danio rerio OX=7955 GN=ihhb PE=2 SV=1
12	Q15465	9.67e-162	464	462	0.616	0.548	SHH_HUMAN Sonic hedgehog protein OS=Homo sapiens OX=9606 GN=SHH PE=1 SV=1
13	O43323	2.04e-154	443	396	0.552	0.573	DHH_HUMAN Desert hedgehog protein OS=Homo sapiens OX=9606 GN=DHH PE=1 SV=1
14	Q61488	2.67e-154	443	396	0.545	0.566	DHH_MOUSE Desert hedgehog protein OS=Mus musculus OX=10090 GN=Dhh PE=1 SV=1
15	G3V7Y0	7.22e-154	442	396	0.543	0.563	G3V7Y0_RAT Hedgehog protein OS=Rattus norvegicus OX=10116 GN=Dhh PE=3 SV=1
16	Q02936	1.59e-110	334	471	0.457	0.399	HH_DROME Protein hedgehog OS=Drosophila melanogaster OX=7227 GN=hh PE=1 SV=4
17	Q9WUP6	1.68e-62	199	129	0.221	0.705	Q9WUP6_RAT Desert hedgehog protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Dhh PE=2 SV=1
18	Q21835	2.95e-11	67.8	1137	0.105	0.038	Q21835_CAEEL Ground-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=grd-1 PE=1 SV=4
19	Q9XV14	4.90e-11	67.0	946	0.109	0.048	Q9XV14_CAEEL Ground-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=grd-2 PE=1 SV=2
20	Q94128	5.33e-09	60.1	485	0.107	0.091	WRT1_CAEEL Warthog protein 1 OS=Caenorhabditis elegans OX=6239 GN=wrt-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01085 HH_signal	1.2e-81	283.7	Hedgehog amino-terminal signalling domain
2	PF01079 Hint	1.2e-65	232.5	Hint module
3	PF08291 Peptidase_M15_3	0.9	21.1	Peptidase M15

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295731

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332353	0.999	Protein patched homolog 1
2	9606.ENSP00000361266	0.996	Protein patched homolog 2
3	9606.ENSP00000296575	0.989	Hedgehog-interacting protein
4	9606.ENSP00000441765	0.985	Parathyroid hormone-related protein
5	9606.ENSP00000249373	0.981	Smoothened homolog
6	9606.ENSP00000360493	0.977	Runt-related transcription factor 2
7	9606.ENSP00000438468	0.967	Protein-cysteine N-palmitoyltransferase HHAT
8	9606.ENSP00000376458	0.965	Cell adhesion molecule-related/down-regulated by oncogenes
9	9606.ENSP00000377836	0.950	Glypican-3
10	9606.ENSP00000418663	0.938	Brother of CDO
11	9606.ENSP00000228682	0.920	Zinc finger protein GLI1
12	9606.ENSP00000262435	0.920	E3 ubiquitin-protein ligase SMURF2
13	9606.ENSP00000354621	0.920	E3 ubiquitin-protein ligase SMURF1
14	9606.ENSP00000387310	0.919	Palmitoleoyl-protein carboxylesterase NOTUM
15	9606.ENSP00000390436	0.907	Zinc finger protein GLI2
16	9606.ENSP00000309968	0.905	Disintegrin and metalloproteinase domain-containing protein 17
17	9606.ENSP00000304697	0.904	Polyubiquitin-B
18	9606.ENSP00000415151	0.904	Core-binding factor subunit beta
19	9606.ENSP00000441543	0.904	Polyubiquitin-C
20	9606.ENSP00000266991	0.903	Desert hedgehog protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005113	0.998	patched binding
GO:0005509	0.898	calcium ion binding
GO:0098772	0.660	molecular function regulator activity
GO:0140677	0.604	molecular function activator activity
GO:0003824	0.550	catalytic activity
GO:0030546	0.543	signaling receptor activator activity
GO:0140096	0.433	catalytic activity, acting on a protein
GO:0016787	0.376	hydrolase activity
GO:0008233	0.370	peptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0050896	0.991	response to stimulus
GO:0007275	0.989	multicellular organism development
GO:0048518	0.985	positive regulation of biological process
GO:0048513	0.985	animal organ development
GO:0048522	0.984	positive regulation of cellular process
GO:0051716	0.983	cellular response to stimulus
GO:0023052	0.975	signaling
GO:0001501	0.975	skeletal system development
GO:0048583	0.973	regulation of response to stimulus
GO:0007165	0.967	signal transduction
GO:0009653	0.965	anatomical structure morphogenesis
GO:0030326	0.960	embryonic limb morphogenesis
GO:0009966	0.950	regulation of signal transduction
GO:0060255	0.939	regulation of macromolecule metabolic process
GO:0061448	0.938	connective tissue development
GO:0007166	0.937	cell surface receptor signaling pathway
GO:0048869	0.930	cellular developmental process
GO:0007224	0.930	smoothened signaling pathway
GO:0042733	0.915	embryonic digit morphogenesis
GO:0030154	0.912	cell differentiation
GO:0048519	0.897	negative regulation of biological process
GO:0048523	0.894	negative regulation of cellular process
GO:0001649	0.888	osteoblast differentiation
GO:0008589	0.881	regulation of smoothened signaling pathway
GO:0042127	0.861	regulation of cell population proliferation
GO:0009893	0.860	positive regulation of metabolic process
GO:0060348	0.834	bone development
GO:0051216	0.823	cartilage development
GO:0071704	0.813	organic substance metabolic process
GO:0045880	0.811	positive regulation of smoothened signaling pathway
GO:0031323	0.802	regulation of cellular metabolic process
GO:0044238	0.793	primary metabolic process
GO:0045597	0.779	positive regulation of cell differentiation
GO:0009887	0.775	animal organ morphogenesis
GO:0043170	0.772	macromolecule metabolic process
GO:0008284	0.765	positive regulation of cell population proliferation
GO:0007399	0.753	nervous system development
GO:0080090	0.747	regulation of primary metabolic process
GO:0006807	0.730	nitrogen compound metabolic process
GO:0051171	0.699	regulation of nitrogen compound metabolic process
GO:0042221	0.687	response to chemical
GO:0051239	0.684	regulation of multicellular organismal process
GO:0048468	0.682	cell development
GO:0061035	0.639	regulation of cartilage development
GO:0010468	0.601	regulation of gene expression
GO:0048732	0.590	gland development
GO:0010604	0.576	positive regulation of macromolecule metabolic process
GO:0009889	0.511	regulation of biosynthetic process
GO:0031325	0.505	positive regulation of cellular metabolic process
GO:0031326	0.472	regulation of cellular biosynthetic process
GO:0010556	0.462	regulation of macromolecule biosynthetic process
GO:0060284	0.457	regulation of cell development
GO:0019219	0.455	regulation of nucleobase-containing compound metabolic process
GO:0009891	0.451	positive regulation of biosynthetic process
GO:0006355	0.436	regulation of DNA-templated transcription
GO:0051173	0.425	positive regulation of nitrogen compound metabolic process
GO:0044237	0.418	cellular metabolic process
GO:0048705	0.413	skeletal system morphogenesis
GO:1901564	0.405	organonitrogen compound metabolic process
GO:0031328	0.389	positive regulation of cellular biosynthetic process
GO:0010557	0.388	positive regulation of macromolecule biosynthetic process
GO:0000003	0.378	reproduction
GO:0045893	0.371	positive regulation of DNA-templated transcription
GO:0022414	0.361	reproductive process
GO:0022008	0.361	neurogenesis
GO:0019538	0.324	protein metabolic process
GO:0051093	0.322	negative regulation of developmental process
GO:0065009	0.311	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.994	cell periphery
GO:0005886	0.970	plasma membrane
GO:0005615	0.879	extracellular space
GO:0043227	0.636	membrane-bounded organelle
GO:0005622	0.563	intracellular anatomical structure
GO:0005737	0.447	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.376	Hydrolases.
EC:3.4.-.-	0.370	Acting on peptide bonds (peptidases).

[back to server]