StarFunc result for job id Q14627

User Input

>input (380 residues)
MAFVCLAIGCLYTFLISTTFGCTSSSDTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLD
HFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQ
SSWAETTYWISPQGIPETKVQDMDCVYYNWQYLLCSWKPGIGVLLDTNYNLFYWYEGLDH
ALQCVDYIKADGQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLP
PVYLTFTRESSCEIKLKWSIPLGPIPARCFDYEIEIREDDTTLVTATVENETYTLKTTNE
TRQLCFVVRSKVNIYCSDDGIWSEWSDKQCWEGEDLSKKTLLRFWLPFGFILILVIFVTG
LLLRKPNTYPKMIPEFFCDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14627	1.000	1.000	1.262E-69	380	1.000	1.000	Q14627.pdb.gz	I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL13RA2 PE=1 SV=1
2	AFDB:Q8VHK6	0.846	0.836	4.737E-46	385	0.526	0.519	Q8VHK6.pdb.gz	I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
3	AFDB:Q01344	0.708	0.646	6.339E-26	420	0.253	0.229	Q01344.pdb.gz	IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL5RA PE=1 SV=2
4	AFDB:G3V6S7	0.703	0.604	1.094E-25	448	0.245	0.208	G3V6S7.pdb.gz	G3V6S7_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=2
5	AFDB:P21183	0.689	0.635	2.191E-25	415	0.237	0.217	P21183.pdb.gz	IL5RA_MOUSE Interleukin-5 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il5ra PE=1 SV=1
6	AFDB:Q561K3	0.663	0.599	4.012E-23	426	0.242	0.216	Q561K3.pdb.gz	Q561K3_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
7	AFDB:P78552	0.675	0.606	4.216E-23	427	0.229	0.204	P78552.pdb.gz	I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL13RA1 PE=1 SV=1
8	AFDB:E6ZCC8	0.577	0.568	2.253E-19	387	0.163	0.160	E6ZCC8.pdb.gz	E6ZCC8_ONCMY IL-13 receptor-alpha-1-a OS=Oncorhynchus mykiss OX=8022 GN=il13Ra1A PE=2 SV=1
9	AFDB:P15509	0.581	0.554	1.279E-18	400	0.171	0.163	P15509.pdb.gz	CSF2R_HUMAN Granulocyte-macrophage colony-stimulating factor receptor subunit alpha OS=Homo sapiens OX=9606 GN=CSF2RA PE=1 SV=1
10	AFDB:Q04594	0.408	0.203	1.640E-18	831	0.218	0.100	Q04594.pdb.gz	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1
11	PDB:7u7nC	0.388	0.662	1.037E-9	200	0.089	0.170	7u7nC.pdb.gz
12	PDB:7z0lB	0.412	0.422	7.932E-9	370	0.097	0.100	7z0lB.pdb.gz
13	PDB:5mj3A	0.328	0.398	1.240E-8	302	0.105	0.132	5mj3A.pdb.gz
14	PDB:8eyyA	0.242	0.134	1.439E-8	775	0.111	0.054	8eyyA.pdb.gz
15	PDB:6pxvA	0.246	0.129	4.504E-8	823	0.116	0.053	6pxvA.pdb.gz
16	PDB:8dtlA	0.228	0.128	4.733E-8	741	0.113	0.058	8dtlA.pdb.gz
17	PDB:6pyhD	0.236	0.128	1.996E-7	798	0.105	0.050	6pyhD.pdb.gz
18	PDB:3besR	0.315	0.438	2.160E-6	250	0.087	0.132	3besR.pdb.gz
19	PDB:4lnvB	0.151	0.077	3.839E-5	1063	0.084	0.030	4lnvB.pdb.gz
20	PDB:1e07A	0.276	0.179	4.455E-5	642	0.092	0.055	1e07A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14627	0.0	782	380	1.000	1.000	I13R2_HUMAN Interleukin-13 receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=IL13RA2 PE=1 SV=1
2	O88786	6.08e-146	420	383	0.537	0.533	I13R2_MOUSE Interleukin-13 receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Il13ra2 PE=1 SV=1
3	Q8VHK6	2.21e-144	416	385	0.516	0.509	I13R2_RAT Interleukin-13 receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Il13ra2 PE=2 SV=1
4	Q01344	7.38e-25	107	420	0.253	0.229	IL5RA_HUMAN Interleukin-5 receptor subunit alpha OS=Homo sapiens OX=9606 GN=IL5RA PE=1 SV=2
5	A0A8I6A7D4	1.71e-24	105	390	0.197	0.192	A0A8I6A7D4_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
6	Q561K3	2.02e-24	105	426	0.258	0.230	Q561K3_RAT Interleukin 13 receptor subunit alpha 1 OS=Rattus norvegicus OX=10116 GN=Il13ra1 PE=4 SV=1
7	P78552	6.98e-21	95.5	427	0.203	0.180	I13R1_HUMAN Interleukin-13 receptor subunit alpha-1 OS=Homo sapiens OX=9606 GN=IL13RA1 PE=1 SV=1
8	G3V6S7	4.49e-17	84.7	448	0.253	0.214	G3V6S7_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=2
9	P21183	6.68e-17	84.0	415	0.232	0.212	IL5RA_MOUSE Interleukin-5 receptor subunit alpha OS=Mus musculus OX=10090 GN=Il5ra PE=1 SV=1
10	P31785	1.45e-16	82.4	369	0.158	0.163	IL2RG_HUMAN Cytokine receptor common subunit gamma OS=Homo sapiens OX=9606 GN=IL2RG PE=1 SV=1
11	A0A8I6A448	7.81e-16	80.5	403	0.224	0.211	A0A8I6A448_RAT Interleukin 5 receptor subunit alpha OS=Rattus norvegicus OX=10116 GN=Il5ra PE=4 SV=1
12	P34902	1.04e-15	80.1	369	0.171	0.176	IL2RG_MOUSE Cytokine receptor common subunit gamma OS=Mus musculus OX=10090 GN=Il2rg PE=1 SV=1
13	Q04594	2.26e-15	80.1	831	0.255	0.117	PRLR_CHICK Prolactin receptor OS=Gallus gallus OX=9031 GN=PRLR PE=2 SV=1
14	Q99PS3	6.33e-15	77.8	414	0.247	0.227	Q99PS3_RAT Interleukin-5 receptor alpha chain OS=Rattus norvegicus OX=10116 GN=Il5ra PE=2 SV=1
15	Q90374	3.48e-11	67.0	830	0.226	0.104	PRLR_COLLI Prolactin receptor OS=Columba livia OX=8932 GN=PRLR PE=2 SV=1
16	F1N4H8	2.23e-08	57.4	296	0.155	0.199	F1N4H8_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=3 SV=2
17	Q2PBN9	6.75e-08	56.6	581	0.155	0.102	Q2PBN9_BOVIN Prolactin receptor (Fragment) OS=Bos taurus OX=9913 GN=prlr PE=3 SV=1
18	Q28172	8.34e-08	56.2	581	0.163	0.107	PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=1 SV=1
19	P26954	9.36e-08	56.6	878	0.208	0.090	IL3B2_MOUSE Interleukin-3 receptor class 2 subunit beta OS=Mus musculus OX=10090 GN=Csf2rb2 PE=1 SV=1
20	A8WH93	1.47e-07	55.1	362	0.137	0.144	A8WH93_DANRE Interleukin 2 receptor gamma common.a OS=Danio rerio OX=7955 GN=il-2rgc.a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13359 DDE_Tnp_4	5.7e+02	11.6	DDE superfamily endonuclease
2	PF09067 EpoR_lig-bind	0.09	24.3	Erythropoietin receptor, ligand binding
3	PF00041 fn3	0.013	27.2	Fibronectin type III domain
4	PF09240 IL6Ra-bind	2.5e-27	106.5	Interleukin-6 receptor alpha chain, binding
5	PF09294 Interfer-bind	8.3e+02	11.7	Interferon-alpha/beta receptor, fibronectin type III
6	PF18207 LIFR_N	2.5e+02	13.3	Leukemia inhibitory factor receptor N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361004

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304915	0.999	Interleukin-13
2	9606.ENSP00000231449	0.952	Interleukin-4
3	9606.ENSP00000255409	0.947	Chitinase-3-like protein 1
4	9606.ENSP00000379111	0.938	Interleukin-4 receptor subunit alpha
5	9606.ENSP00000343204	0.854	Tyrosine-protein kinase JAK1
6	9606.ENSP00000457492	0.812	Insulin-like growth factor-binding protein 3 receptor
7	9606.ENSP00000229135	0.753	Interferon gamma
8	9606.ENSP00000343000	0.743	Interleukin-19
9	9606.ENSP00000231454	0.730	Interleukin-5
10	9606.ENSP00000412237	0.720	Interleukin-10
11	9606.ENSP00000264563	0.719	Interleukin-11
12	9606.ENSP00000385675	0.707	Interleukin-6
13	9606.ENSP00000296545	0.697	Interleukin-15
14	9606.ENSP00000226730	0.684	Interleukin-2
15	9606.ENSP00000225474	0.675	Granulocyte colony-stimulating factor
16	9606.ENSP00000296871	0.675	Granulocyte-macrophage colony-stimulating factor
17	9606.ENSP00000339804	0.668	Thymic stromal lymphopoietin
18	9606.ENSP00000274520	0.666	Interleukin-9
19	9606.ENSP00000265171	0.659	Pro-epidermal growth factor
20	9606.ENSP00000391676	0.654	Tyrosine-protein kinase JAK3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050789	0.993	regulation of biological process
GO:0009987	0.988	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0048518	0.962	positive regulation of biological process
GO:0019222	0.894	regulation of metabolic process
GO:0060255	0.884	regulation of macromolecule metabolic process
GO:0051716	0.839	cellular response to stimulus
GO:0010468	0.783	regulation of gene expression
GO:0048522	0.778	positive regulation of cellular process
GO:0048583	0.773	regulation of response to stimulus
GO:0051239	0.676	regulation of multicellular organismal process
GO:0007154	0.582	cell communication
GO:0009893	0.556	positive regulation of metabolic process
GO:0009605	0.549	response to external stimulus
GO:0010604	0.523	positive regulation of macromolecule metabolic process
GO:0002376	0.522	immune system process
GO:0048519	0.480	negative regulation of biological process
GO:0050865	0.472	regulation of cell activation
GO:0048523	0.458	negative regulation of cellular process
GO:0002694	0.419	regulation of leukocyte activation
GO:0051240	0.399	positive regulation of multicellular organismal process
GO:0023052	0.392	signaling
GO:0002684	0.386	positive regulation of immune system process
GO:0042127	0.376	regulation of cell population proliferation
GO:0006955	0.353	immune response
GO:0080090	0.352	regulation of primary metabolic process
GO:0008284	0.350	positive regulation of cell population proliferation
GO:0051171	0.348	regulation of nitrogen compound metabolic process
GO:0010628	0.344	positive regulation of gene expression
GO:0042221	0.341	response to chemical
GO:0006950	0.327	response to stress
GO:0031323	0.324	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.997	extracellular space
GO:0016020	0.755	membrane
GO:0071944	0.629	cell periphery
GO:0005886	0.612	plasma membrane
GO:0005622	0.376	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]