StarFunc result for job id Q14642

User Input

>input (412 residues)
MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKN
YEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQF
DFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDL
VNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSK
SVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVMLQLEKKLFDYFNQEVFRDNNGT
ALLEFDKELSVFKDRLYELDISFPPSYPYSEDARQGEQYMNTRCPAWCDRILMSPSAKEL
VLRSESEEKVVTYDHIGPNVCMGDHKPVFLAFRIMPGAGKPHAHVHKCCVVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZZX1	0.990	0.990	7.420E-95	412	0.971	0.971	D3ZZX1.pdb.gz	I5P1_RAT Inositol polyphosphate-5-phosphatase A OS=Rattus norvegicus OX=10116 GN=Inpp5a PE=1 SV=1
2	AFDB:B7Z0Q1	0.888	0.757	6.915E-56	485	0.437	0.371	B7Z0Q1.pdb.gz	B7Z0Q1_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=3 SV=2
3	AFDB:B7Z0Q2	0.894	0.533	1.215E-54	699	0.439	0.259	B7Z0Q2.pdb.gz	B7Z0Q2_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=3 SV=1
4	AFDB:Q17848	0.874	0.880	4.578E-48	409	0.379	0.381	Q17848.pdb.gz	I5P1_CAEEL Probable type I inositol 1,4,5-trisphosphate 5-phosphatase OS=Caenorhabditis elegans OX=6239 GN=ipp-5 PE=2 SV=2
5	AFDB:Q385E2	0.674	0.502	5.554E-25	564	0.231	0.168	Q385E2.pdb.gz	Q385E2_TRYB2 inositol-polyphosphate 5-phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4140 PE=3 SV=1
6	AFDB:O14306	0.517	0.196	8.292E-16	1191	0.180	0.062	O14306.pdb.gz	YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9G1.10c PE=1 SV=2
7	AFDB:D7PF45	0.509	0.187	9.393E-16	1260	0.182	0.060	D7PF45.pdb.gz	SHIP2_PIG Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Sus scrofa OX=9823 GN=INPPL1 PE=1 SV=2
8	AFDB:P50942	0.490	0.191	1.546E-15	1183	0.170	0.059	P50942.pdb.gz	INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP52 PE=1 SV=1
9	AFDB:G5ECL2	0.525	0.213	1.864E-15	1119	0.141	0.052	G5ECL2.pdb.gz	SYNJ_CAEEL Synaptojanin OS=Caenorhabditis elegans OX=6239 GN=unc-26 PE=1 SV=1
10	AFDB:O46094	0.510	0.262	1.864E-15	850	0.143	0.069	O46094.pdb.gz	O46094_DROME EG:86E4.5 protein OS=Drosophila melanogaster OX=7227 GN=Ocrl PE=1 SV=1
11	PDB:2imqX	0.478	0.673	1.599E-12	280	0.138	0.204	2imqX.pdb.gz	Heme-assisted S-nitrosation of a proximal thiolate in a nitric oxide transport protein
12	PDB:4f1iA	0.358	0.435	2.197E-10	328	0.102	0.128	4f1iA.pdb.gz
13	PDB:1akoA	0.390	0.552	2.210E-8	268	0.109	0.168	1akoA.pdb.gz
14	PDB:2o3cB	0.321	0.430	2.352E-8	280	0.138	0.204	2o3cB.pdb.gz
15	PDB:7ax1A	0.378	0.315	2.665E-8	518	0.107	0.085	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
16	PDB:7kiuA	0.356	0.510	7.686E-8	263	0.100	0.156	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
17	PDB:2j63A	0.385	0.455	3.650E-7	333	0.114	0.141	2j63A.pdb.gz
18	PDB:6o1kA	0.360	0.515	8.205E-7	262	0.097	0.153	6o1kA.pdb.gz	Architectural principles for Hfq/Crc-mediated regulation of gene expression
19	PDB:2a3zB	0.346	0.501	1.120E-6	260	0.092	0.146	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly
20	PDB:7cd5A	0.341	0.466	1.844E-6	278	0.114	0.169	7cd5A.pdb.gz	APE1 distinguishes DNA substrates in exonucleolytic cleavage by induced space-filling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZZX1	0.0	846	412	0.971	0.971	I5P1_RAT Inositol polyphosphate-5-phosphatase A OS=Rattus norvegicus OX=10116 GN=Inpp5a PE=1 SV=1
2	Q14642	0.0	867	412	1.000	1.000	I5P1_HUMAN Inositol polyphosphate-5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5A PE=1 SV=1
3	Q29467	0.0	845	412	0.966	0.966	I5P1_CANLF Inositol polyphosphate-5-phosphatase A OS=Canis lupus familiaris OX=9615 GN=INPP5A PE=1 SV=1
4	Q7TNC9	0.0	846	412	0.971	0.971	I5P1_MOUSE Inositol polyphosphate-5-phosphatase A OS=Mus musculus OX=10090 GN=Inpp5a PE=1 SV=1
5	B7Z0Q1	5.75e-116	348	485	0.447	0.379	B7Z0Q1_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=3 SV=2
6	Q8IGM4	2.67e-113	348	699	0.447	0.263	Q8IGM4_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=2 SV=1
7	B7Z0Q2	2.79e-113	348	699	0.447	0.263	B7Z0Q2_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=3 SV=1
8	Q8T8Q6	1.44e-110	332	400	0.432	0.445	Q8T8Q6_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=2 SV=1
9	Q8IMU3	1.69e-110	332	400	0.432	0.445	Q8IMU3_DROME inositol-polyphosphate 5-phosphatase OS=Drosophila melanogaster OX=7227 GN=5PtaseI PE=2 SV=1
10	Q17848	2.57e-83	262	409	0.388	0.391	I5P1_CAEEL Probable type I inositol 1,4,5-trisphosphate 5-phosphatase OS=Caenorhabditis elegans OX=6239 GN=ipp-5 PE=2 SV=2
11	Q385E2	4.95e-09	60.5	564	0.228	0.167	Q385E2_TRYB2 inositol-polyphosphate 5-phosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4140 PE=3 SV=1
12	A0A0C5A9Q6	1.91e-05	49.3	1283	0.146	0.047	A0A0C5A9Q6_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase (Fragment) OS=Ictalurus punctatus OX=7998 PE=2 SV=1
13	W5U6G9	2.13e-05	49.3	1256	0.146	0.048	W5U6G9_ICTPU phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase OS=Ictalurus punctatus OX=7998 GN=inppl1a PE=2 SV=1
14	Q2I6J1	2.43e-05	49.3	1266	0.150	0.049	SHP2A_DANRE Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2A OS=Danio rerio OX=7955 GN=inppl1a PE=2 SV=2
15	O14306	9.19e-05	47.4	1191	0.121	0.042	YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9G1.10c PE=1 SV=2
16	Q9VTW2	1.40e-04	46.6	747	0.080	0.044	INP5E_DROME Inositol polyphosphate 5-phosphatase E OS=Drosophila melanogaster OX=7227 GN=INPP5E PE=1 SV=1
17	D7PF45	1.42e-04	46.6	1260	0.133	0.044	SHIP2_PIG Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Sus scrofa OX=9823 GN=INPPL1 PE=1 SV=2
18	Q08227	1.42e-04	46.2	384	0.078	0.083	INP54_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=INP54 PE=1 SV=1
19	O15357	1.71e-04	46.6	1258	0.133	0.044	SHIP2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 2 OS=Homo sapiens OX=9606 GN=INPPL1 PE=1 SV=2
20	Q01968	2.24e-04	45.8	901	0.155	0.071	OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL OS=Homo sapiens OX=9606 GN=OCRL PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03372 Exo_endo_phos	9.6e-18	76.2	Endonuclease/Exonuclease/phosphatase family
2	PF11790 Glyco_hydro_cc	6	17.9	Glycosyl hydrolase catalytic core
3	PF02191 OLF	1.5e+02	13.4	Olfactomedin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357583

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260386	0.965	Inositol-trisphosphate 3-kinase A
2	9606.ENSP00000263370	0.958	Inositol-trisphosphate 3-kinase C
3	9606.ENSP00000411152	0.958	Inositol-trisphosphate 3-kinase B
4	9606.ENSP00000333262	0.948	Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A
5	9606.ENSP00000074304	0.942	Type I inositol 3,4-bisphosphate 4-phosphatase
6	9606.ENSP00000361064	0.933	Multiple inositol polyphosphate phosphatase 1
7	9606.ENSP00000425487	0.924	Type II inositol 3,4-bisphosphate 4-phosphatase
8	9606.ENSP00000267615	0.918	Inositol-tetrakisphosphate 1-kinase
9	9606.ENSP00000376142	0.916	Inositol polyphosphate-1-phosphatase
10	9606.ENSP00000361021	0.912	Phosphatase and tensin homolog
11	9606.ENSP00000363046	0.911	Inositol polyphosphate multikinase
12	9606.ENSP00000360431	0.901	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
13	9606.ENSP00000413937	0.857	Inositol polyphosphate 5-phosphatase K
14	9606.ENSP00000367747	0.796	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2
15	9606.ENSP00000345988	0.791	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1
16	9606.ENSP00000261308	0.788	Peptidylprolyl isomerase domain and WD repeat-containing protein 1
17	9606.ENSP00000264220	0.788	Amidophosphoribosyltransferase
18	9606.ENSP00000244007	0.773	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
19	9606.ENSP00000362107	0.771	Four and a half LIM domains 3
20	9606.ENSP00000377710	0.769	Four and a half LIM domains protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004445	1.000	inositol-polyphosphate 5-phosphatase activity
GO:0005515	0.867	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0044238	0.992	primary metabolic process
GO:0006066	0.992	alcohol metabolic process
GO:0006796	0.988	phosphate-containing compound metabolic process
GO:0043647	0.973	inositol phosphate metabolic process
GO:0050794	0.965	regulation of cellular process
GO:0016311	0.916	dephosphorylation
GO:0005975	0.907	carbohydrate metabolic process
GO:0044262	0.785	cellular carbohydrate metabolic process
GO:1901616	0.752	organic hydroxy compound catabolic process
GO:0046164	0.742	alcohol catabolic process
GO:0046174	0.731	polyol catabolic process
GO:0046434	0.706	organophosphate catabolic process
GO:1901214	0.659	regulation of neuron death
GO:0048519	0.509	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0016020	0.990	membrane
GO:0071944	0.985	cell periphery
GO:0005886	0.984	plasma membrane
GO:0042995	0.975	cell projection
GO:0120025	0.957	plasma membrane bounded cell projection
GO:0036477	0.951	somatodendritic compartment
GO:0043005	0.951	neuron projection
GO:0030425	0.914	dendrite
GO:0005737	0.847	cytoplasm
GO:0043226	0.746	organelle
GO:0043227	0.744	membrane-bounded organelle
GO:0043231	0.644	intracellular membrane-bounded organelle
GO:0005829	0.600	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.56	1.000	inositol-polyphosphate 5-phosphatase.

[back to server]