StarFunc result for job id Q14643

User Input

>input (1400 residues)
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTIFPISKMAKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAA
PEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSE
TSSGNSSQEGPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMH
DYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSE
LWVYKGQGPDETMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQE
SASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQ
NQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIK
FLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSP
LMYHIHLVELLAVCTEGKNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6dr0C	0.778	0.508	0.000	2193	0.615	0.393	6dr0C.pdb.gz	Structural basis for the regulation of inositol trisphosphate receptors by Ca2+and IP3.
2	PDB:7lhfB	0.679	0.427	0.000	2300	0.859	0.523	7lhfB.pdb.gz	Cryo-EM structure of type 1 IP3R channel in a lipid bilayer
3	PDB:7t3pA	0.738	0.511	0.000	2066	0.604	0.409	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
4	PDB:7t3qA	0.741	0.506	0.000	2103	0.604	0.402	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
5	PDB:7t3rA	0.743	0.503	0.000	2130	0.608	0.400	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
6	AFDB:A0A0R4IH08	0.744	0.416	0.000	2634	0.623	0.331	A0A0R4IH08.pdb.gz	A0A0R4IH08_DANRE Inositol 1,4,5-trisphosphate receptor OS=Danio rerio OX=7955 GN=si:dkey-163f12.8 PE=3 SV=2
7	AFDB:Q14573	0.766	0.422	0.000	2671	0.639	0.335	Q14573.pdb.gz	ITPR3_HUMAN Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2
8	PDB:6uqkA	0.682	0.479	3.483E-104	2054	0.596	0.407	6uqkA.pdb.gz	Cryo-EM structure of human type-3 inositol triphosphate receptor reveals the presence of a self-binding peptide that acts as an antagonist.
9	PDB:7t3uA	0.559	0.412	7.483E-102	2020	0.585	0.405	7t3uA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
10	PDB:6mu2A	0.621	0.419	1.079E-86	2170	0.807	0.521	6mu2A.pdb.gz
11	PDB:3javA	0.461	0.283	5.334E-58	2327	0.779	0.469	3javA.pdb.gz
12	PDB:7t3uC	0.463	0.415	6.995E-57	1575	0.381	0.338	7t3uC.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
13	AFDB:F1QLD3	0.129	0.741	6.954E-18	232	0.099	0.599	F1QLD3.pdb.gz
14	AFDB:F4J246	0.117	0.116	1.642E-3	1415	0.086	0.086	F4J246.pdb.gz	F4J246_ARATH Condensin-1 complex subunit CAP-D2 OS=Arabidopsis thaliana OX=3702 GN=At3g57060 PE=1 SV=1
15	AFDB:Q94FN2	0.086	0.070	1.780E-3	1978	0.104	0.074	Q94FN2.pdb.gz	MOR1_ARATH Protein MOR1 OS=Arabidopsis thaliana OX=3702 GN=MOR1 PE=1 SV=1
16	AFDB:A5HEI1	0.134	0.114	1.929E-3	1846	0.090	0.068	A5HEI1.pdb.gz	SCC2_ARATH Sister chromatid cohesion protein SCC2 OS=Arabidopsis thaliana OX=3702 GN=SCC2 PE=1 SV=1
17	AFDB:Q9VE34	0.105	0.076	2.770E-3	2455	0.084	0.048	Q9VE34.pdb.gz	EPG5_DROME Ectopic P granules protein 5 homolog OS=Drosophila melanogaster OX=7227 GN=Epg5 PE=1 SV=2
18	AFDB:Q9XZ34	0.097	0.096	4.141E-3	1416	0.074	0.073	Q9XZ34.pdb.gz	RIF1_DROME Telomere-associated protein RIF1 OS=Drosophila melanogaster OX=7227 GN=Rif1 PE=1 SV=1
19	AFDB:B5DFK6	0.131	0.146	4.672E-3	1204	0.061	0.071	B5DFK6.pdb.gz	B5DFK6_RAT Adaptor related protein complex 3 subunit delta 1 OS=Rattus norvegicus OX=10116 GN=Ap3d1 PE=1 SV=1
20	AFDB:O14617	0.135	0.156	7.880E-3	1153	0.057	0.069	O14617.pdb.gz	AP3D1_HUMAN AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IH08	0.0	1757	2634	0.631	0.335	A0A0R4IH08_DANRE Inositol 1,4,5-trisphosphate receptor OS=Danio rerio OX=7955 GN=si:dkey-163f12.8 PE=3 SV=2
2	P11881	0.0	2871	2749	0.986	0.502	ITPR1_MOUSE Inositol 1,4,5-trisphosphate receptor type 1 OS=Mus musculus OX=10090 GN=Itpr1 PE=1 SV=2
3	P29993	0.0	1665	2838	0.630	0.311	ITPR_DROME Inositol 1,4,5-trisphosphate receptor OS=Drosophila melanogaster OX=7227 GN=Itpr PE=2 SV=3
4	P29994	0.0	2867	2750	0.987	0.503	ITPR1_RAT Inositol 1,4,5-trisphosphate receptor type 1 OS=Rattus norvegicus OX=10116 GN=Itpr1 PE=1 SV=2
5	P29995	0.0	1981	2701	0.704	0.365	ITPR2_RAT Inositol 1,4,5-trisphosphate receptor type 2 OS=Rattus norvegicus OX=10116 GN=Itpr2 PE=1 SV=1
6	P70227	0.0	1818	2670	0.646	0.339	ITPR3_MOUSE Inositol 1,4,5-trisphosphate receptor type 3 OS=Mus musculus OX=10090 GN=Itpr3 PE=1 SV=3
7	Q14571	0.0	1985	2701	0.705	0.365	ITPR2_HUMAN Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2
8	Q14573	0.0	1801	2671	0.651	0.341	ITPR3_HUMAN Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens OX=9606 GN=ITPR3 PE=1 SV=2
9	Q14643	0.0	2919	2758	1.000	0.508	ITPR1_HUMAN Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 PE=1 SV=3
10	Q63269	0.0	1821	2670	0.651	0.341	ITPR3_RAT Inositol 1,4,5-trisphosphate receptor type 3 OS=Rattus norvegicus OX=10116 GN=Itpr3 PE=1 SV=1
11	Q8WN95	0.0	1798	2664	0.652	0.343	ITPR3_BOVIN Inositol 1,4,5-trisphosphate receptor type 3 OS=Bos taurus OX=9913 GN=ITPR3 PE=2 SV=1
12	Q8WN96	0.0	1992	2701	0.708	0.367	ITPR2_BOVIN Inositol 1,4,5-trisphosphate receptor type 2 OS=Bos taurus OX=9913 GN=ITPR2 PE=2 SV=1
13	Q91908	0.0	2578	2693	0.889	0.462	Q91908_XENLA Inositol 1,4,5-trisphosphate receptor OS=Xenopus laevis OX=8355 GN=itpr1.S PE=1 SV=1
14	Q9TU34	0.0	2858	2709	0.983	0.508	ITPR1_BOVIN Inositol 1,4,5-trisphosphate receptor type 1 OS=Bos taurus OX=9913 GN=ITPR1 PE=1 SV=1
15	Q9Y0A1	0.0	930	2892	0.421	0.204	ITPR_CAEEL Inositol 1,4,5-trisphosphate receptor itr-1 OS=Caenorhabditis elegans OX=6239 GN=itr-1 PE=1 SV=1
16	Q9Z329	0.0	1981	2701	0.705	0.365	ITPR2_MOUSE Inositol 1,4,5-trisphosphate receptor type 2 OS=Mus musculus OX=10090 GN=Itpr2 PE=1 SV=4
17	Q94279	2.18e-18	94.7	5201	0.111	0.030	Q94279_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=6
18	I2HAA7	2.73e-18	94.4	5071	0.111	0.031	I2HAA7_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2
19	B7WN66	2.83e-18	94.4	5085	0.111	0.031	B7WN66_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=5
20	I2HAA6	2.88e-18	94.4	5187	0.111	0.030	I2HAA6_CAEEL Ryanodine receptor 44F OS=Caenorhabditis elegans OX=6239 GN=unc-68 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08709 Ins145_P3_rec	1.3e-89	310.6	Inositol 1,4,5-trisphosphate/ryanodine receptor
2	PF02815 MIR	5e-69	243.4	MIR domain
3	PF01365 RYDR_ITPR	8.5e-78	272.0	RIH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008954853.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003813027.2	0.978	Huntingtin
2	9597.XP_003818203.1	0.975	Murine retrovirus integration site 1 homolog
3	9597.XP_003813957.1	0.949	Beclin-1 isoform X1
4	9597.XP_008953651.1	0.944	Ankyrin-2 isoform X1
5	9597.XP_008967631.1	0.944	Belongs to the protein kinase superfamily.
6	9597.XP_003824183.1	0.941	Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
7	9597.XP_008967828.1	0.941	Phospholipase C zeta 1
8	9597.XP_003814910.1	0.935	Belongs to the protein kinase superfamily.
9	9597.XP_003824803.1	0.935	Belongs to the protein kinase superfamily.
10	9597.XP_003825944.1	0.933	Phospholipase C gamma 1
11	9597.XP_003820933.1	0.927	Phospholipase C gamma 2
12	9597.XP_008953806.1	0.902	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
13	9597.XP_003830787.1	0.897	ER lipid raft associated 2
14	9597.XP_008956129.1	0.890	Ataxin 2
15	9597.XP_008960164.1	0.890	Stromal interaction molecule 1
16	9597.XP_008964521.1	0.883	Protein kinase C beta type isoform X1
17	9597.XP_003832824.1	0.881	Ataxin 3
18	9597.XP_003814978.1	0.880	Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.
19	9597.XP_008976465.1	0.876	Beclin 2
20	9597.XP_008961145.1	0.872	Phospholipase C beta 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005220	1.000	inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity
GO:0043167	0.905	ion binding
GO:0043168	0.755	anion binding
GO:0036094	0.742	small molecule binding
GO:0043178	0.657	alcohol binding
GO:0070679	0.335	inositol 1,4,5 trisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0006816	0.989	calcium ion transport
GO:0009987	0.978	cellular process
GO:0048519	0.965	negative regulation of biological process
GO:0051716	0.964	cellular response to stimulus
GO:0048523	0.959	negative regulation of cellular process
GO:0070482	0.955	response to oxygen levels
GO:0032502	0.948	developmental process
GO:0006950	0.938	response to stress
GO:0070588	0.930	calcium ion transmembrane transport
GO:0036293	0.928	response to decreased oxygen levels
GO:0032501	0.921	multicellular organismal process
GO:0065008	0.893	regulation of biological quality
GO:0001666	0.892	response to hypoxia
GO:1901698	0.869	response to nitrogen compound
GO:0051282	0.868	regulation of sequestering of calcium ion
GO:0070887	0.832	cellular response to chemical stimulus
GO:0097553	0.832	calcium ion transmembrane import into cytosol
GO:0014074	0.792	response to purine-containing compound
GO:0046683	0.789	response to organophosphorus
GO:0071310	0.787	cellular response to organic substance
GO:0071407	0.782	cellular response to organic cyclic compound
GO:0023051	0.776	regulation of signaling
GO:0051283	0.775	negative regulation of sequestering of calcium ion
GO:0051209	0.772	release of sequestered calcium ion into cytosol
GO:0023052	0.763	signaling
GO:0007154	0.739	cell communication
GO:0048518	0.735	positive regulation of biological process
GO:0007165	0.718	signal transduction
GO:0010646	0.715	regulation of cell communication
GO:0048522	0.708	positive regulation of cellular process
GO:1901700	0.706	response to oxygen-containing compound
GO:1901701	0.637	cellular response to oxygen-containing compound
GO:1901699	0.566	cellular response to nitrogen compound
GO:0071495	0.537	cellular response to endogenous stimulus
GO:0048583	0.530	regulation of response to stimulus
GO:0071417	0.527	cellular response to organonitrogen compound
GO:0051591	0.508	response to cAMP
GO:0033554	0.497	cellular response to stress
GO:0048856	0.486	anatomical structure development
GO:0007204	0.399	positive regulation of cytosolic calcium ion concentration
GO:0007275	0.358	multicellular organism development
GO:0051049	0.347	regulation of transport
GO:1902074	0.327	response to salt
GO:0071320	0.305	cellular response to cAMP

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0031090	0.996	organelle membrane
GO:0042175	0.986	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.972	endoplasmic reticulum membrane
GO:0071944	0.948	cell periphery
GO:0031982	0.820	vesicle
GO:0098588	0.755	bounding membrane of organelle
GO:0005634	0.708	nucleus
GO:0005886	0.694	plasma membrane
GO:0032991	0.653	protein-containing complex
GO:0031410	0.574	cytoplasmic vesicle
GO:0099503	0.445	secretory vesicle
GO:0030054	0.436	cell junction
GO:0045202	0.422	synapse
GO:0042995	0.420	cell projection
GO:0043005	0.397	neuron projection
GO:0031095	0.369	platelet dense tubular network membrane
GO:0005829	0.347	cytosol
GO:0016528	0.318	sarcoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]