StarFunc result for job id Q14653

User Input

>input (427 residues)
MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEA
TGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQP
DTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPT
PFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPG
WPVTLPDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELL
PNSGHGPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTK
RLVMVKVVPTCLRALVEMARVGGASSLENTVDLHISNSHPLSLTSDQYKAYLQDLVEGMD
FQGPGES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14653	1.000	1.000	5.050E-90	427	1.000	1.000	Q14653.pdb.gz	IRF3_HUMAN Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
2	AFDB:Q764M6	0.579	0.589	2.008E-71	419	0.768	0.783	Q764M6.pdb.gz	IRF3_PIG Interferon regulatory factor 3 OS=Sus scrofa OX=9823 GN=IRF3 PE=1 SV=1
3	AFDB:Q5XIB0	0.565	0.573	2.885E-65	421	0.728	0.739	Q5XIB0.pdb.gz	Q5XIB0_RAT Interferon regulatory factor 3 OS=Rattus norvegicus OX=10116 GN=Irf3 PE=2 SV=1
4	AFDB:P70671	0.534	0.544	8.476E-63	419	0.689	0.702	P70671.pdb.gz	IRF3_MOUSE Interferon regulatory factor 3 OS=Mus musculus OX=10090 GN=Irf3 PE=1 SV=1
5	AFDB:M0QZB7	0.414	0.433	2.446E-59	408	0.780	0.816	M0QZB7.pdb.gz	M0QZB7_HUMAN Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
6	AFDB:M0R3C2	0.339	0.536	3.365E-34	264	0.616	0.996	M0R3C2.pdb.gz	M0R3C2_HUMAN Interferon regulatory factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
7	AFDB:C0HAD6	0.453	0.405	5.406E-31	482	0.321	0.284	C0HAD6.pdb.gz	C0HAD6_SALSA Interferon regulatory factor 3 OS=Salmo salar OX=8030 GN=IRF3 PE=2 SV=1
8	AFDB:B5X2E7	0.408	0.419	9.542E-30	415	0.265	0.272	B5X2E7.pdb.gz	B5X2E7_SALSA Interferon regulatory factor 7 OS=Salmo salar OX=8030 GN=IRF7 PE=2 SV=1
9	AFDB:M9RSF4	0.385	0.340	1.138E-29	487	0.293	0.257	M9RSF4.pdb.gz	M9RSF4_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=1
10	AFDB:Q92985	0.404	0.347	1.438E-29	503	0.311	0.264	Q92985.pdb.gz	IRF7_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=2
11	PDB:7dvqX	0.180	0.426	2.613E-1	156	0.037	0.103	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:3j4qB	0.081	0.089	7.501E-1	382	0.075	0.084	3j4qB.pdb.gz
13	PDB:3afoA	0.070	0.080	8.942E-1	360	0.033	0.039	3afoA.pdb.gz	The structural factor conferring NADH kinase activity on yeast mitochondrial Pos5
14	PDB:1u0rD	0.076	0.101	9.482E-1	301	0.033	0.047	1u0rD.pdb.gz
15	PDB:3b2dC	0.069	0.172	1.066	139	0.033	0.101	3b2dC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:5nalB	0.050	0.139	1.066	150	0.005	0.013	5nalB.pdb.gz	Covalent Protein Labeling at Glutamic Acids.
17	PDB:1u0tB	0.068	0.096	1.130	276	0.035	0.054	1u0tB.pdb.gz
18	PDB:5z56X	0.173	0.387	1.130	159	0.026	0.069	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
19	PDB:5ijdC	0.087	0.169	1.199	137	0.030	0.095	5ijdC.pdb.gz	TLR4/MD-2 activation by a synthetic agonist with no similarity to LPS.
20	PDB:7q6dA	0.082	0.091	1.199	383	0.056	0.063	7q6dA.pdb.gz	Bacterial divisome protein FtsA forms curved antiparallel double filaments when binding to FtsN.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F7EXX5	0.0	611	466	0.738	0.676	F7EXX5_RAT Interferon regulatory factor 3 OS=Rattus norvegicus OX=10116 GN=Irf3 PE=1 SV=1
2	M0QZB7	0.0	667	408	0.773	0.809	M0QZB7_HUMAN Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
3	M0R205	0.0	582	287	0.672	1.000	M0R205_HUMAN Interferon regulatory factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
4	P70671	0.0	587	419	0.707	0.721	IRF3_MOUSE Interferon regulatory factor 3 OS=Mus musculus OX=10090 GN=Irf3 PE=1 SV=1
5	Q14653	0.0	868	427	1.000	1.000	IRF3_HUMAN Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
6	Q3U9K6	0.0	587	419	0.707	0.721	Q3U9K6_MOUSE IRF tryptophan pentad repeat domain-containing protein OS=Mus musculus OX=10090 GN=Irf3 PE=1 SV=1
7	Q5XIB0	0.0	609	421	0.738	0.748	Q5XIB0_RAT Interferon regulatory factor 3 OS=Rattus norvegicus OX=10116 GN=Irf3 PE=2 SV=1
8	Q764M6	0.0	661	419	0.768	0.783	IRF3_PIG Interferon regulatory factor 3 OS=Sus scrofa OX=9823 GN=IRF3 PE=1 SV=1
9	M0R3C2	1.32e-141	406	264	0.468	0.758	M0R3C2_HUMAN Interferon regulatory factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
10	M0QYX3	6.32e-135	387	190	0.445	1.000	M0QYX3_HUMAN Interferon regulatory factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=8
11	M0R3E9	5.33e-100	296	153	0.337	0.941	M0R3E9_HUMAN Interferon regulatory factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
12	F9UKU0	6.49e-46	165	415	0.288	0.296	F9UKU0_ONCMY Interferon regulatory factor 7 OS=Oncorhynchus mykiss OX=8022 GN=irf-7 PE=2 SV=1
13	P56477	1.15e-44	164	497	0.335	0.288	IRF5_MOUSE Interferon regulatory factor 5 OS=Mus musculus OX=10090 GN=Irf5 PE=1 SV=1
14	B5X2E7	3.72e-44	160	415	0.283	0.292	B5X2E7_SALSA Interferon regulatory factor 7 OS=Salmo salar OX=8030 GN=IRF7 PE=2 SV=1
15	B6CBU8	5.18e-44	160	415	0.283	0.292	B6CBU8_SALSA Interferon regulatory factor 7 OS=Salmo salar OX=8030 PE=2 SV=1
16	D3ZPU1	6.23e-44	162	497	0.337	0.290	D3ZPU1_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
17	B7SEE0	1.13e-42	157	426	0.309	0.310	B7SEE0_DANRE Interferon regulatory factor 3 OS=Danio rerio OX=7955 GN=irf3 PE=1 SV=1
18	A0A8I5YBA0	2.72e-42	158	536	0.335	0.267	A0A8I5YBA0_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
19	A0A0G2JUR2	3.56e-42	157	528	0.335	0.271	A0A0G2JUR2_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=2
20	Q13568	3.80e-42	157	498	0.335	0.287	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00605 IRF	2.7e-30	116.1	Interferon regulatory factor transcription factor
2	PF10401 IRF-3	9.1e-50	180.4	Interferon-regulatory factor 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000011485

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000007974	0.990	CREB binding protein
2	9601.ENSPPYP00000005386	0.949	TANK-binding kinase 1
3	9601.ENSPPYP00000012072	0.934	Mitochondrial antiviral signaling protein
4	9601.ENSPPYP00000013236	0.931	E1A binding protein p300
5	9601.ENSPPYP00000001511	0.928	Jun proto-oncogene, AP-1 transcription factor subunit
6	9601.ENSPPYP00000000308	0.908	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon
7	9601.ENSPPYP00000017715	0.903	Transmembrane protein 173
8	9601.ENSPPYP00000010561	0.891	Toll-like receptor adaptor molecule 1
9	9601.ENSPPYP00000020804	0.870	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
10	9601.ENSPPYP00000009268	0.867	Tripartite motif containing 25
11	9601.ENSPPYP00000002343	0.866	ISG15 ubiquitin-like modifier
12	9601.ENSPPYP00000002975	0.857	Conserved helix-loop-helix ubiquitous kinase
13	9601.ENSPPYP00000015644	0.856	Uncharacterized protein DKFZp469E1714
14	9601.ENSPPYP00000017042	0.850	Belongs to the Toll-like receptor family.
15	9601.ENSPPYP00000021493	0.847	Interferon, beta 1, fibroblast
16	9601.ENSPPYP00000007003	0.846	Belongs to the TNF receptor-associated factor family.
17	9601.ENSPPYP00000010696	0.844	Peptidyl-prolyl cis-trans isomerase
18	9601.ENSPPYP00000003533	0.838	RELA proto-oncogene, NF-kB subunit
19	9601.ENSPPYP00000021908	0.835	Belongs to the Toll-like receptor family.
20	9601.ENSPPYP00000021455	0.814	DExD/H-box helicase 58

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	1.000	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0042802	0.996	identical protein binding
GO:0001216	0.934	DNA-binding transcription activator activity
GO:0019904	0.904	protein domain specific binding
GO:0000978	0.858	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.737	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0046983	0.652	protein dimerization activity
GO:0042803	0.539	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.979	cellular response to stimulus
GO:0048583	0.977	regulation of response to stimulus
GO:0048522	0.977	positive regulation of cellular process
GO:0010033	0.976	response to organic substance
GO:0010628	0.975	positive regulation of gene expression
GO:0071310	0.972	cellular response to organic substance
GO:0051239	0.969	regulation of multicellular organismal process
GO:0051254	0.968	positive regulation of RNA metabolic process
GO:0048584	0.966	positive regulation of response to stimulus
GO:0001817	0.964	regulation of cytokine production
GO:0009966	0.959	regulation of signal transduction
GO:0051240	0.957	positive regulation of multicellular organismal process
GO:1902680	0.954	positive regulation of RNA biosynthetic process
GO:0001819	0.953	positive regulation of cytokine production
GO:0043331	0.942	response to dsRNA
GO:0098542	0.942	defense response to other organism
GO:0009615	0.938	response to virus
GO:0006355	0.936	regulation of DNA-templated transcription
GO:0002376	0.929	immune system process
GO:0032479	0.918	regulation of type I interferon production
GO:0043122	0.918	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0007165	0.911	signal transduction
GO:0045893	0.899	positive regulation of DNA-templated transcription
GO:0002682	0.895	regulation of immune system process
GO:0032481	0.895	positive regulation of type I interferon production
GO:0023056	0.887	positive regulation of signaling
GO:0010647	0.887	positive regulation of cell communication
GO:0045088	0.885	regulation of innate immune response
GO:0050778	0.879	positive regulation of immune response
GO:0032648	0.878	regulation of interferon-beta production
GO:0071407	0.877	cellular response to organic cyclic compound
GO:1901699	0.865	cellular response to nitrogen compound
GO:0045089	0.865	positive regulation of innate immune response
GO:0006955	0.852	immune response
GO:0008219	0.841	cell death
GO:0009967	0.835	positive regulation of signal transduction
GO:0043330	0.828	response to exogenous dsRNA
GO:0045087	0.827	innate immune response
GO:0034097	0.817	response to cytokine
GO:0032728	0.814	positive regulation of interferon-beta production
GO:1902533	0.808	positive regulation of intracellular signal transduction
GO:0007166	0.790	cell surface receptor signaling pathway
GO:0071345	0.782	cellular response to cytokine stimulus
GO:0002221	0.763	pattern recognition receptor signaling pathway
GO:0048519	0.666	negative regulation of biological process
GO:0051607	0.646	defense response to virus
GO:0043123	0.582	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0019221	0.557	cytokine-mediated signaling pathway
GO:0045944	0.541	positive regulation of transcription by RNA polymerase II
GO:0002224	0.515	toll-like receptor signaling pathway
GO:0012501	0.465	programmed cell death
GO:0010941	0.406	regulation of cell death
GO:0042981	0.373	regulation of apoptotic process
GO:0048523	0.369	negative regulation of cellular process
GO:0008152	0.368	metabolic process
GO:0071704	0.340	organic substance metabolic process
GO:0033554	0.321	cellular response to stress
GO:0032502	0.304	developmental process
GO:0065009	0.301	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005634	0.997	nucleus
GO:0070013	0.866	intracellular organelle lumen
GO:0031981	0.864	nuclear lumen
GO:0005654	0.821	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]