StarFunc result for job id Q14654

User Input

>input (390 residues)
MLSRKGIIPEEYVLTRLAEDPAEPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTIKVPTPLCTARQLDEDHSLLEALT
LASARGPLRKRSVPMAKAKPKFSISPDSLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70673	0.963	0.963	4.916E-74	390	0.962	0.962	P70673.pdb.gz	KCJ11_RAT ATP-sensitive inward rectifier potassium channel 11 OS=Rattus norvegicus OX=10116 GN=Kcnj11 PE=1 SV=1
2	PDB:7tysA	0.845	0.912	1.033E-62	361	0.892	0.964	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
3	AFDB:Q2HX26	0.867	0.887	1.915E-58	381	0.705	0.722	Q2HX26.pdb.gz	Q2HX26_DANRE ATP-sensitive inward rectifier potassium channel 11 OS=Danio rerio OX=7955 GN=kir6.2 PE=2 SV=1
4	AFDB:P97794	0.820	0.755	6.215E-57	424	0.690	0.634	P97794.pdb.gz	KCNJ8_MOUSE ATP-sensitive inward rectifier potassium channel 8 OS=Mus musculus OX=10090 GN=Kcnj8 PE=1 SV=1
5	AFDB:Q5R205	0.835	0.754	4.813E-55	432	0.656	0.593	Q5R205.pdb.gz	Q5R205_DANRE Kir6.3 protein OS=Danio rerio OX=7955 GN=zKir6.2 PE=2 SV=1
6	PDB:7mjpA	0.709	0.751	1.972E-48	366	0.674	0.719	7mjpA.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
7	AFDB:P48542	0.799	0.734	3.744E-46	425	0.438	0.402	P48542.pdb.gz	KCNJ6_MOUSE G protein-activated inward rectifier potassium channel 2 OS=Mus musculus OX=10090 GN=Kcnj6 PE=1 SV=1
8	AFDB:P48543	0.829	0.823	4.455E-46	393	0.446	0.443	P48543.pdb.gz	KCNJ9_MOUSE G protein-activated inward rectifier potassium channel 3 OS=Mus musculus OX=10090 GN=Kcnj9 PE=1 SV=2
9	AFDB:A0A0R4ICH9	0.812	0.726	7.086E-46	437	0.451	0.403	A0A0R4ICH9.pdb.gz	A0A0R4ICH9_DANRE ATP-sensitive inward rectifier potassium channel 12-like OS=Danio rerio OX=7955 GN=kcnj12a PE=3 SV=1
10	AFDB:Q8IGY2	0.840	0.728	7.509E-46	452	0.433	0.374	Q8IGY2.pdb.gz	Q8IGY2_DROME RE07647p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Irk2 PE=2 SV=1
11	AFDB:P35561	0.818	0.746	1.265E-45	428	0.438	0.400	P35561.pdb.gz	KCNJ2_MOUSE Inward rectifier potassium channel 2 OS=Mus musculus OX=10090 GN=Kcnj2 PE=1 SV=1
12	AFDB:B7U540	0.810	0.731	1.506E-45	433	0.456	0.411	B7U540.pdb.gz	KCJ18_HUMAN Inward rectifier potassium channel 18 OS=Homo sapiens OX=9606 GN=KCNJ18 PE=1 SV=3
13	PDB:7zdzA	0.665	0.778	6.303E-31	325	0.418	0.502	7zdzA.pdb.gz
14	PDB:1xl6A	0.638	0.833	8.263E-22	291	0.218	0.292	1xl6A.pdb.gz
15	PDB:1xo8A	0.145	0.286	2.536E-3	151	0.033	0.086	1xo8A.pdb.gz
16	PDB:1yvlB	0.178	0.117	3.199E-3	653	0.044	0.026	1yvlB.pdb.gz	Structural bases of unphosphorylated STAT1 association and receptor binding.
17	PDB:5a1uE	0.148	0.079	6.054E-3	824	0.059	0.028	5a1uE.pdb.gz
18	PDB:4gojC	0.132	0.259	7.634E-3	161	0.031	0.075	4gojC.pdb.gz	Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
19	PDB:6eo1A	0.224	0.244	8.573E-3	355	0.082	0.090	6eo1A.pdb.gz
20	PDB:7kzpQ	0.190	0.114	9.085E-3	754	0.067	0.034	7kzpQ.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70673	0.0	758	390	0.962	0.962	KCJ11_RAT ATP-sensitive inward rectifier potassium channel 11 OS=Rattus norvegicus OX=10116 GN=Kcnj11 PE=1 SV=1
2	P97794	0.0	555	424	0.682	0.627	KCNJ8_MOUSE ATP-sensitive inward rectifier potassium channel 8 OS=Mus musculus OX=10090 GN=Kcnj8 PE=1 SV=1
3	Q14654	0.0	803	390	0.995	0.995	KCJ11_HUMAN ATP-sensitive inward rectifier potassium channel 11 OS=Homo sapiens OX=9606 GN=KCNJ11 PE=1 SV=3
4	Q15842	0.0	555	424	0.679	0.625	KCNJ8_HUMAN ATP-sensitive inward rectifier potassium channel 8 OS=Homo sapiens OX=9606 GN=KCNJ8 PE=1 SV=1
5	Q2HX26	0.0	572	381	0.692	0.709	Q2HX26_DANRE ATP-sensitive inward rectifier potassium channel 11 OS=Danio rerio OX=7955 GN=kir6.2 PE=2 SV=1
6	Q5R205	0.0	521	432	0.638	0.576	Q5R205_DANRE Kir6.3 protein OS=Danio rerio OX=7955 GN=zKir6.2 PE=2 SV=1
7	Q61743	0.0	779	390	0.964	0.964	KCJ11_MOUSE ATP-sensitive inward rectifier potassium channel 11 OS=Mus musculus OX=10090 GN=Kcnj11 PE=1 SV=1
8	Q63664	0.0	555	424	0.695	0.639	KCNJ8_RAT ATP-sensitive inward rectifier potassium channel 8 OS=Rattus norvegicus OX=10116 GN=Kcnj8 PE=1 SV=1
9	G3I1T3	1.32e-126	404	2352	0.582	0.097	G3I1T3_CRIGR ATP-sensitive inward rectifier potassium channel 11 (Fragment) OS=Cricetulus griseus OX=10029 GN=I79_017352 PE=1 SV=1
10	Q63511	6.27e-121	357	393	0.428	0.425	KCNJ9_RAT G protein-activated inward rectifier potassium channel 3 OS=Rattus norvegicus OX=10116 GN=Kcnj9 PE=1 SV=2
11	P48543	8.05e-121	357	393	0.428	0.425	KCNJ9_MOUSE G protein-activated inward rectifier potassium channel 3 OS=Mus musculus OX=10090 GN=Kcnj9 PE=1 SV=2
12	Q92806	8.98e-121	357	393	0.428	0.425	KCNJ9_HUMAN G protein-activated inward rectifier potassium channel 3 OS=Homo sapiens OX=9606 GN=KCNJ9 PE=1 SV=2
13	P48542	1.04e-120	358	425	0.415	0.381	KCNJ6_MOUSE G protein-activated inward rectifier potassium channel 2 OS=Mus musculus OX=10090 GN=Kcnj6 PE=1 SV=1
14	P48051	1.54e-120	357	423	0.415	0.383	KCNJ6_HUMAN G protein-activated inward rectifier potassium channel 2 OS=Homo sapiens OX=9606 GN=KCNJ6 PE=1 SV=1
15	P48550	6.20e-120	356	425	0.415	0.381	KCNJ6_RAT G protein-activated inward rectifier potassium channel 2 OS=Rattus norvegicus OX=10116 GN=Kcnj6 PE=1 SV=1
16	Q14500	1.70e-119	355	433	0.438	0.395	KCJ12_HUMAN ATP-sensitive inward rectifier potassium channel 12 OS=Homo sapiens OX=9606 GN=KCNJ12 PE=1 SV=2
17	P52188	4.83e-119	353	427	0.436	0.398	KCJ12_RAT ATP-sensitive inward rectifier potassium channel 12 OS=Rattus norvegicus OX=10116 GN=Kcnj12 PE=1 SV=1
18	B7U540	2.25e-118	352	433	0.438	0.395	KCJ18_HUMAN Inward rectifier potassium channel 18 OS=Homo sapiens OX=9606 GN=KCNJ18 PE=1 SV=3
19	P63252	3.93e-117	349	427	0.433	0.396	KCNJ2_HUMAN Inward rectifier potassium channel 2 OS=Homo sapiens OX=9606 GN=KCNJ2 PE=1 SV=1
20	P35561	6.55e-117	348	428	0.426	0.388	KCNJ2_MOUSE Inward rectifier potassium channel 2 OS=Mus musculus OX=10090 GN=Kcnj2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07264 EI24	1.5e+02	14.0	Etoposide-induced protein 2.4 (EI24)
2	PF07885 Ion_trans_2	2.4e+02	13.1	Ion channel
3	PF01007 IRK	9e-54	192.6	Inward rectifier potassium channel transmembrane domain
4	PF17655 IRK_C	2.9e-63	224.2	Inward rectifier potassium channel C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003818259.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008969732.1	0.996	ATP binding cassette subfamily C member 8
2	9597.XP_008952570.1	0.969	ATP binding cassette subfamily C member 9
3	9597.XP_008968899.1	0.825	ATP binding cassette subfamily C member 3
4	9597.XP_003832392.2	0.765	Diablo homolog, mitochondrial isoform X1
5	9597.XP_008953651.1	0.744	Ankyrin-2 isoform X1
6	9597.XP_008976252.1	0.742	Rap guanine nucleotide exchange factor 4
7	9597.XP_003804221.1	0.729	Multidrug resistance-associated protein 6-like isoform X1
8	9597.XP_003825508.1	0.729	ATP binding cassette subfamily C member 2
9	9597.XP_008957827.1	0.729	Multidrug resistance-associated protein 6-like
10	9597.XP_008957837.1	0.729	Multidrug resistance-associated protein 1
11	9597.XP_003829770.1	0.705	Gamma-aminobutyric acid type B receptor subunit 1 isoform X1
12	9597.XP_003820673.2	0.704	Gamma-aminobutyric acid type B receptor subunit 2
13	9597.XP_008960908.1	0.670	GC-rich sequence DNA-binding factor 2 isoform X1
14	9597.XP_008976979.1	0.666	ATP-binding cassette sub-family B member 5
15	9597.XP_003832042.1	0.653	ATP binding cassette subfamily C member 5
16	9597.XP_003832175.1	0.653	ATP binding cassette subfamily C member 4
17	9597.XP_008971451.1	0.653	ATP binding cassette subfamily C member 12
18	9597.XP_003823235.1	0.648	CDK5 regulatory subunit associated protein 1 like 1
19	9597.XP_008949174.1	0.647	Transcription factor 7 like 2
20	9597.XP_008949361.1	0.647	Rap guanine nucleotide exchange factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005242	0.998	inward rectifier potassium channel activity
GO:0005488	0.996	binding
GO:0005515	0.994	protein binding
GO:0030506	0.675	ankyrin binding
GO:0042626	0.348	ATPase-coupled transmembrane transporter activity
GO:0022853	0.342	active monoatomic ion transmembrane transporter activity
GO:0015272	0.339	ATP-activated inward rectifier potassium channel activity
GO:0036094	0.310	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.993	biological regulation
GO:0006810	0.986	transport
GO:0050794	0.981	regulation of cellular process
GO:0030001	0.981	metal ion transport
GO:0006813	0.974	potassium ion transport
GO:0098662	0.963	inorganic cation transmembrane transport
GO:0071805	0.954	potassium ion transmembrane transport
GO:0065008	0.943	regulation of biological quality
GO:0032879	0.873	regulation of localization
GO:0048523	0.843	negative regulation of cellular process
GO:0050896	0.810	response to stimulus
GO:0051051	0.809	negative regulation of transport
GO:0032880	0.747	regulation of protein localization
GO:0032501	0.573	multicellular organismal process
GO:0070201	0.491	regulation of establishment of protein localization
GO:0010646	0.480	regulation of cell communication
GO:0051046	0.477	regulation of secretion
GO:0048518	0.474	positive regulation of biological process
GO:0051716	0.473	cellular response to stimulus
GO:0023051	0.472	regulation of signaling
GO:0008152	0.452	metabolic process
GO:0042221	0.414	response to chemical
GO:0071704	0.369	organic substance metabolic process
GO:0051223	0.359	regulation of protein transport
GO:0048522	0.357	positive regulation of cellular process
GO:0050708	0.346	regulation of protein secretion
GO:0090276	0.345	regulation of peptide hormone secretion
GO:0044238	0.336	primary metabolic process
GO:0010033	0.319	response to organic substance
GO:0050796	0.306	regulation of insulin secretion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:1990351	0.982	transporter complex
GO:0034703	0.973	cation channel complex
GO:0098797	0.972	plasma membrane protein complex
GO:0034705	0.952	potassium channel complex
GO:0005622	0.764	intracellular anatomical structure
GO:0043226	0.760	organelle
GO:0043231	0.699	intracellular membrane-bounded organelle
GO:0005737	0.605	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	0.998	K(+)(in) = K(+)(out)
EC:7.-.-.-	0.348	Translocases.

[back to server]