StarFunc result for job id Q14669

User Input

>input (1992 residues)
MSNRPNNNPGGSLRRSQRNTAGAQPQDDSIGGRSCSSSSAVIVPQPEDPDRANTSERQKT
GQVPKKDNSRGVKRSASPDYNRTNSPSSAKKPKALQHTESPSETNKPHSKSKKRHLDQEQ
QLKSAQSPSTSKAHTRKSGATGGSRSQKRKRTESSCVKSGSGSESTGAEERSAKPTKLAS
KSATSAKAGCSTITDSSSAASTSSSSSAVASASSTVPPGARVKQGKDQNKARRSRSASSP
SPRRSSREKEQSKTGGSSKFDWAARFSPKVSLPKTKLSLPGSSKSETSKPGPSGLQAKLA
SLRKSTKKRSESPPAELPSLRRSTRQKTTGSCASTSRRGSGLGKRGAAEARRQEKMADPE
SNQEAVNSSAARTDEAPQGAAGAVGMTTSGESESDDSEMGRLQALLEARGLPPHLFGPLG
PRMSQLFHRTIGSGASSKAQQLLQGLQASDESQQLQAVIEMCQLLVMGNEETLGGFPVKS
VVPALITLLQMEHNFDIMNHACRALTYMMEALPRSSAVVVDAIPVFLEKLQVIQCIDVAE
QALTALEMLSRRHSKAILQAGGLADCLLYLEFFSINAQRNALAIAANCCQSITPDEFHFV
ADSLPLLTQRLTHQDKKSVESTCLCFARLVDNFQHEENLLQQVASKDLLTNVQQLLVVTP
PILSSGMFIMVVRMFSLMCSNCPTLAVQLMKQNIAETLHFLLCGASNGSCQEQIDLVPRS
PQELYELTSLICELMPCLPKEGIFAVDTMLKKGNAQNTDGAIWQWRDDRGLWHPYNRIDS
RIIEQINEDTGTARAIQRKPNPLANSNTSGYSESKKDDARAQLMKEDPELAKSFIKTLFG
VLYEVYSSSAGPAVRHKCLRAILRIIYFADAELLKDVLKNHAVSSHIASMLSSQDLKIVV
GALQMAEILMQKLPDIFSVYFRREGVMHQVKHLAESESLLTSPPKACTNGSGSMGSTTSV
SSGTATAATHAAADLGSPSLQHSRDDSLDLSPQGRLSDVLKRKRLPKRGPRRPKYSPPRD
DDKVDNQAKSPTTTQSPKSSFLASLNPKTWGRLSTQSNSNNIEPARTAGGSGLARAASKD
TISNNREKIKGWIKEQAHKFVERYFSSENMDGSNPALNVLQRLCAATEQLNLQVDGGAEC
LVEIRSIVSESDVSSFEIQHSGFVKQLLLYLTSKSEKDAVSREIRLKRFLHVFFSSPLPG
EEPIGRVEPVGNAPLLALVHKMNNCLSQMEQFPVKVHDFPSGNGTGGSFSLNRGSQALKF
FNTHQLKCQLQRHPDCANVKQWKGGPVKIDPLALVQAIERYLVVRGYGRVREDDEDSDDD
GSDEEIDESLAAQFLNSGNVRHRLQFYIGEHLLPYNMTVYQAVRQFSIQAEDERESTDDE
SNPLGRAGIWTKTHTIWYKPVREDEESNKDCVGGKRGRAQTAPTKTSPRNAKKHDELWHD
GVCPSVSNPLEVYLIPTPPENITFEDPSLDVILLLRVLHAISRYWYYLYDNAMCKEIIPT
SEFINSKLTAKANRQLQDPLVIMTGNIPTWLTELGKTCPFFFPFDTRQMLFYVTAFDRDR
AMQRLLDTNPEINQSDSQDSRVAPRLDRKKRTVNREELLKQAESVMQDLGSSRAMLEIQY
ENEVGTGLGPTLEFYALVSQELQRADLGLWRGEEVTLSNPKGSQEGTKYIQNLQGLFALP
FGRTAKPAHIAKVKMKFRFLGKLMAKAIMDFRLVDLPLGLPFYKWMLRQETSLTSHDLFD
IDPVVARSVYHLEDIVRQKKRLEQDKSQTKESLQYALETLTMNGCSVEDLGLDFTLPGFP
NIELKKGGKDIPVTIHNLEEYLRLVIFWALNEGVSRQFDSFRDGFESVFPLSHLQYFYPE
ELDQLLCGSKADTWDAKTLMECCRPDHGYTHDSRAVKFLFEILSSFDNEQQRLFLQFVTG
SPRLPVGGFRSLNPPLTIVRKTFESTENPDDFLPSVMTCVNYLKLPDYSSIEIMREKLLI
AAREGQQSFHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5E870	0.785	0.772	0.000	2025	0.980	0.964	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
2	AFDB:Q14669	1.000	1.000	0.000	1992	1.000	1.000	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
3	PDB:7jq9A	0.103	0.090	3.403E-15	2427	0.126	0.103	7jq9A.pdb.gz
4	PDB:7mopA	0.107	0.095	3.683E-15	2445	0.132	0.107	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
5	AFDB:F1RBK4	0.148	0.226	2.494E-10	1216	0.082	0.134	F1RBK4.pdb.gz
6	AFDB:A0A0K3AU72	0.091	0.103	4.695E-10	1698	0.122	0.144	A0A0K3AU72.pdb.gz	A0A0K3AU72_CAEEL Formin HOmology Domain OS=Caenorhabditis elegans OX=6239 GN=fhod-1 PE=1 SV=1
7	PDB:3tpoA	0.158	0.591	1.350E-9	438	0.041	0.185	3tpoA.pdb.gz
8	AFDB:Q68CQ1	0.076	0.103	2.028E-9	1323	0.076	0.115	Q68CQ1.pdb.gz	MROH7_HUMAN Maestro heat-like repeat-containing protein family member 7 OS=Homo sapiens OX=9606 GN=MROH7 PE=2 SV=4
9	PDB:4tnmA	0.160	0.661	4.601E-9	407	0.040	0.194	4tnmA.pdb.gz
10	PDB:5tbkA	0.156	0.612	2.238E-8	417	0.035	0.168	5tbkA.pdb.gz
11	PDB:1wa5B	0.167	0.624	4.049E-8	466	0.041	0.174	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
12	PDB:7rroH7	0.120	0.323	6.508E-8	580	0.044	0.150	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
13	PDB:2z6gA	0.145	0.424	1.493E-7	550	0.031	0.111	2z6gA.pdb.gz
14	PDB:6kbnC	0.135	0.468	5.087E-7	504	0.037	0.145	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
15	PDB:7nscE	0.111	0.301	7.860E-7	615	0.035	0.112	7nscE.pdb.gz
16	AFDB:Q585G4	0.107	0.187	5.517E-6	988	0.074	0.150	Q585G4.pdb.gz	Q585G4_TRYB2 Pumilio/PUF RNA binding protein 4, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.50 PE=4 SV=1
17	AFDB:P25339	0.097	0.178	1.605E-5	888	0.065	0.145	P25339.pdb.gz	PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF4 PE=1 SV=2
18	AFDB:O43432	0.060	0.069	2.291E-5	1585	0.086	0.108	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
19	AFDB:Q80U58	0.109	0.180	2.579E-5	1066	0.063	0.117	Q80U58.pdb.gz	PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus OX=10090 GN=Pum2 PE=1 SV=2
20	AFDB:Q09829	0.087	0.173	3.143E-5	780	0.055	0.140	Q09829.pdb.gz	YAD3_SCHPO Pumilio domain-containing protein C4G8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G8.03c PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5E870	0.0	4043	2025	0.983	0.967	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
2	Q14669	0.0	4132	1992	1.000	1.000	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
3	A0A0B4JDB5	6.80e-171	583	2737	0.162	0.118	A0A0B4JDB5_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
4	A0A0B4LHQ4	6.99e-171	583	2708	0.162	0.119	A0A0B4LHQ4_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
5	A0A0B4JD62	9.92e-171	583	2736	0.162	0.118	A0A0B4JD62_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
6	A0A0B4JCV6	1.36e-170	583	2930	0.162	0.110	A0A0B4JCV6_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
7	A0A0B4LGQ5	1.39e-170	583	2901	0.162	0.111	A0A0B4LGQ5_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
8	A0A0B4JCW5	1.54e-170	583	2929	0.162	0.110	A0A0B4JCW5_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
9	Q9VN58	1.91e-170	583	3140	0.162	0.103	Q9VN58_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=4
10	A0A0B4LGR2	2.29e-170	583	3111	0.162	0.104	A0A0B4LGR2_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
11	A0A0B4JDA1	2.54e-170	583	3139	0.162	0.103	A0A0B4JDA1_DROME E3 ubiquitin-protein ligase OS=Drosophila melanogaster OX=7227 GN=ctrip PE=1 SV=1
12	Q6WWW4	1.67e-121	428	1888	0.136	0.144	UPL3_ARATH E3 ubiquitin-protein ligase UPL3 OS=Arabidopsis thaliana OX=3702 GN=UPL3 PE=1 SV=1
13	Q10435	1.09e-97	352	1647	0.143	0.172	YDE1_SCHPO Probable ubiquitin fusion degradation protein C12B10.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC12B10.01c PE=3 SV=2
14	P33202	2.35e-82	303	1483	0.095	0.127	UFD4_YEAST Ubiquitin fusion degradation protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFD4 PE=1 SV=1
15	V6CLA2	6.37e-82	303	2648	0.100	0.076	HECD1_CAEEL E3 ubiquitin-protein ligase hecd-1 OS=Caenorhabditis elegans OX=6239 GN=hecd-1 PE=1 SV=1
16	V6CLA7	6.65e-82	303	2650	0.100	0.075	V6CLA7_CAEEL E3 ubiquitin-protein ligase OS=Caenorhabditis elegans OX=6239 GN=hecd-1 PE=1 SV=1
17	Q9VL06	3.01e-79	295	2727	0.096	0.070	UFD4_DROME E3 ubiquitin-protein ligase Ufd4 OS=Drosophila melanogaster OX=7227 GN=Ufd4 PE=2 SV=1
18	Q382A4	2.38e-70	265	1609	0.096	0.119	Q382A4_TRYB2 HECT-type E3 ubiquitin transferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5930 PE=3 SV=1
19	Q9ULT8	5.63e-45	182	2610	0.050	0.038	HECD1_HUMAN E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=4
20	Q69ZR2	1.20e-43	178	2618	0.050	0.038	HECD1_MOUSE E3 ubiquitin-protein ligase HECTD1 OS=Mus musculus OX=10090 GN=Hectd1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13646 HEAT_2	2.5e+02	13.5	HEAT repeats
2	PF00632 HECT	1.2e-84	296.0	HECT-domain (ubiquitin-transferase)
3	PF11701 UNC45-central	32	15.9	Myosin-binding striated muscle assembly central
4	PF02825 WWE	1	21.4	WWE domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000022237

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000011934	0.963	Ubiquitin ligase protein which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N- terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation.
2	9598.ENSPTRP00000050136	0.963	Ubiquitin protein ligase E3 component n-recognin 2
3	9598.ENSPTRP00000003097	0.899	Ubiquitin-conjugating enzyme E2T (Putative)
4	9598.ENSPTRP00000004338	0.899	Ubiquitin-conjugating enzyme E2D 1
5	9598.ENSPTRP00000009000	0.899	Ubiquitin-conjugating enzyme E2N
6	9598.ENSPTRP00000021716	0.899	Uncharacterized protein
7	9598.ENSPTRP00000025343	0.899	Ubiquitin-conjugating enzyme E2E 1
8	9598.ENSPTRP00000029578	0.899	Ubiquitin-conjugating enzyme E2D 2
9	9598.ENSPTRP00000047232	0.899	Ubiquitin conjugating enzyme E2 N like (gene/pseudogene)
10	9598.ENSPTRP00000060835	0.899	Uncharacterized protein
11	9598.ENSPTRP00000061118	0.899	Uncharacterized protein
12	9598.ENSPTRP00000047397	0.872	HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase
13	9598.ENSPTRP00000015240	0.861	Transcription elongation factor spt6
14	9598.ENSPTRP00000000239	0.850	Uncharacterized protein
15	9598.ENSPTRP00000007445	0.850	Uncharacterized protein
16	9598.ENSPTRP00000022595	0.850	U-box domain containing 5
17	9598.ENSPTRP00000035626	0.848	Phospholipase A2-activating protein
18	9598.ENSPTRP00000016254	0.846	Uncharacterized protein
19	9598.ENSPTRP00000053603	0.843	Snf2-related CREBBP activator protein
20	9598.ENSPTRP00000053773	0.830	Ubiquitin specific peptidase 7 (herpes virus-associated)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061629	1.000	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0046966	0.994	nuclear thyroid hormone receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0019222	0.968	regulation of metabolic process
GO:0060255	0.956	regulation of macromolecule metabolic process
GO:0051171	0.953	regulation of nitrogen compound metabolic process
GO:0080090	0.952	regulation of primary metabolic process
GO:0050794	0.941	regulation of cellular process
GO:0071704	0.932	organic substance metabolic process
GO:0044238	0.929	primary metabolic process
GO:0009987	0.915	cellular process
GO:0006807	0.911	nitrogen compound metabolic process
GO:0043170	0.895	macromolecule metabolic process
GO:0051246	0.796	regulation of protein metabolic process
GO:0048583	0.734	regulation of response to stimulus
GO:0044237	0.720	cellular metabolic process
GO:1901564	0.690	organonitrogen compound metabolic process
GO:0019538	0.674	protein metabolic process
GO:0048519	0.646	negative regulation of biological process
GO:0031323	0.628	regulation of cellular metabolic process
GO:0050896	0.569	response to stimulus
GO:0070647	0.533	protein modification by small protein conjugation or removal
GO:0048518	0.517	positive regulation of biological process
GO:0048523	0.504	negative regulation of cellular process
GO:0044260	0.500	cellular macromolecule metabolic process
GO:0006508	0.479	proteolysis
GO:0051716	0.470	cellular response to stimulus
GO:0019219	0.460	regulation of nucleobase-containing compound metabolic process
GO:0009893	0.450	positive regulation of metabolic process
GO:0010604	0.417	positive regulation of macromolecule metabolic process
GO:0051173	0.388	positive regulation of nitrogen compound metabolic process
GO:0032446	0.383	protein modification by small protein conjugation
GO:0006511	0.347	ubiquitin-dependent protein catabolic process
GO:0071840	0.345	cellular component organization or biogenesis
GO:0006950	0.330	response to stress
GO:0016567	0.327	protein ubiquitination
GO:0048522	0.326	positive regulation of cellular process
GO:0033554	0.311	cellular response to stress
GO:0016043	0.301	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016607	0.988	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]