StarFunc result for job id Q14671

User Input

>input (1186 residues)
MSVACVLKRKAVLWQDSFSPHLKHHPQEPANPNMPVVLTSGTGSQAQPQPAANQALAAGT
HSSPVPGSIGVAGRSQDDAMVDYFFQRQHGEQLGGGGSGGGGYNNSKHRWPTGDNIHAEH
QVRSMDELNHDFQALALEGRAMGEQLLPGKKFWETDESSKDGPKGIFLGDQWRDSAWGTS
DHSVSQPIMVQRRPGQSFHVNSEVNSVLSPRSESGGLGVSMVEYVLSSSPGDSCLRKGGF
GPRDADSDENDKGEKKNKGTFDGDKLGDLKEEGDVMDKTNGLPVQNGIDADVKDFSRTPG
NCQNSANEVDLLGPNQNGSEGLAQLTSTNGAKPVEDFSNMESQSVPLDPMEHVGMEPLQF
DYSGTQVPVDSAAATVGLFDYNSQQQLFQRPNALAVQQLTAAQQQQYALAAAHQPHIGLA
PAAFVPNPYIISAAPPGTDPYTAGLAAAATLGPAVVPHQYYGVTPWGVYPASLFQQQAAA
AAAATNSANQQTTPQAQQGQQQVLRGGASQRPLTPNQNQQGQQTDPLVAAAAVNSALAFG
QGLAAGMPGYPVLAPAAYYDQTGALVVNAGARNGLGAPVRLVAPAPVIISSSAAQAAVAA
AAASANGAAGGLAGTTNGPFRPLGTQQPQPQPQQQPNNNLASSSFYGNNSLNSNSQSSSL
FSQGSAQPANTSLGFGSSSSLGATLGSALGGFGTAVANSNTGSGSRRDSLTGSSDLYKRT
SSSLTPIGHSFYNGLSFSSSPGPVGMPLPSQGPGHSQTPPPSLSSHGSSSSLNLGGLTNG
SGRYISAAPGAEAKYRSASSASSLFSPSSTLFSSSRLRYGMSDVMPSGRSRLLEDFRNNR
YPNLQLREIAGHIMEFSQDQHGSRFIQLKLERATPAERQLVFNEILQAAYQLMVDVFGNY
VIQKFFEFGSLEQKLALAERIRGHVLSLALQMYGCRVIQKALEFIPSDQQNEMVRELDGH
VLKCVKDQNGNHVVQKCIECVQPQSLQFIIDAFKGQVFALSTHPYGCRVIQRILEHCLPD
QTLPILEELHQHTEQLVQDQYGNYVIQHVLEHGRPEDKSKIVAEIRGNVLVLSQHKFASN
VVEKCVTHASRTERAVLIDEVCTMNDGPHSALYTMMKDQYANYVVQKMIDVAEPGQRKIV
MHKIRPHIATLRKYTYGKHILAKLEKYYMKNGVDLGPICGPPNGII

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T1Z8	0.349	0.339	0.000	1224	1.000	0.969	Q5T1Z8.pdb.gz	Q5T1Z8_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
2	AFDB:A0A0R4IWL6	0.466	0.477	3.443E-92	1152	0.802	0.826	A0A0R4IWL6.pdb.gz	A0A0R4IWL6_DANRE Pumilio RNA-binding family member 1 OS=Danio rerio OX=7955 GN=fb96a03 PE=1 SV=2
3	AFDB:Q80U58	0.374	0.411	1.850E-78	1066	0.694	0.772	Q80U58.pdb.gz	PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus OX=10090 GN=Pum2 PE=1 SV=2
4	AFDB:P25822	0.299	0.233	6.518E-45	1533	0.402	0.311	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
5	AFDB:Q8I3S3	0.245	0.159	4.961E-23	1894	0.163	0.102	Q8I3S3.pdb.gz	Q8I3S3_PLAF7 mRNA-binding protein PUF1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518700 PE=4 SV=1
6	AFDB:P25339	0.263	0.347	5.085E-21	888	0.159	0.213	P25339.pdb.gz	PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF4 PE=1 SV=2
7	AFDB:Q9P789	0.195	0.213	1.513E-11	1065	0.160	0.178	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
8	PDB:5svdA	0.183	0.323	1.371E-6	543	0.050	0.109	5svdA.pdb.gz
9	AFDB:Q5H9R4	0.088	0.057	2.663E-4	2290	0.153	0.079	Q5H9R4.pdb.gz	ARMX4_HUMAN Armadillo repeat-containing X-linked protein 4 OS=Homo sapiens OX=9606 GN=ARMCX4 PE=1 SV=3
10	AFDB:E5FYH1	0.100	0.077	7.554E-4	1653	0.126	0.091	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
11	AFDB:Q9W517	0.105	0.082	1.299E-3	1741	0.179	0.122	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
12	PDB:5tbkA	0.181	0.405	1.336E-3	417	0.037	0.106	5tbkA.pdb.gz
13	PDB:3tpoA	0.168	0.357	6.517E-3	438	0.033	0.089	3tpoA.pdb.gz
14	PDB:6xu2A	0.116	0.123	1.381E-2	1091	0.036	0.039	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
15	PDB:7p3xB	0.129	0.206	1.440E-2	621	0.044	0.084	7p3xB.pdb.gz
16	PDB:1wa5B	0.161	0.325	1.849E-2	466	0.039	0.099	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
17	PDB:6n1zA	0.182	0.215	2.185E-2	961	0.040	0.049	6n1zA.pdb.gz
18	PDB:7zf1B	0.141	0.141	2.278E-2	1179	0.043	0.043	7zf1B.pdb.gz
19	PDB:1b3uA	0.138	0.239	2.581E-2	588	0.046	0.092	1b3uA.pdb.gz
20	PDB:4c0qA	0.182	0.233	2.691E-2	871	0.047	0.064	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DG68	0.0	761	876	0.315	0.426	A0A0C4DG68_HUMAN Pumilio RNA binding family member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=1
2	A0A0R4IWL6	0.0	1626	1152	0.798	0.822	A0A0R4IWL6_DANRE Pumilio RNA-binding family member 1 OS=Danio rerio OX=7955 GN=fb96a03 PE=1 SV=2
3	E9PR38	0.0	1627	944	0.675	0.847	E9PR38_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
4	H0YEH2	0.0	1101	1125	0.591	0.623	H0YEH2_HUMAN Pumilio RNA binding family member 1 (Fragment) OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
5	P25822	0.0	583	1533	0.228	0.177	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
6	Q14671	0.0	2438	1186	1.000	1.000	PUM1_HUMAN Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3
7	Q5T1Z4	0.0	2429	1189	1.000	0.997	Q5T1Z4_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
8	Q5T1Z8	0.0	2427	1224	1.000	0.969	Q5T1Z8_HUMAN Pumilio RNA binding family member 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=1
9	Q7SXY5	0.0	650	540	0.341	0.748	Q7SXY5_DANRE Pum1 protein OS=Danio rerio OX=7955 GN=pum1 PE=2 SV=1
10	Q80U58	0.0	1370	1066	0.692	0.770	PUM2_MOUSE Pumilio homolog 2 OS=Mus musculus OX=10090 GN=Pum2 PE=1 SV=2
11	Q80U78	0.0	2404	1189	0.990	0.987	PUM1_MOUSE Pumilio homolog 1 OS=Mus musculus OX=10090 GN=Pum1 PE=1 SV=2
12	Q8TB72	0.0	1378	1066	0.694	0.772	PUM2_HUMAN Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2 PE=1 SV=2
13	S6B5C2	0.0	1625	1152	0.798	0.821	S6B5C2_DANRE Pumilio1 OS=Danio rerio OX=7955 GN=pum1 PE=2 SV=1
14	Q54WA7	1.28e-133	428	785	0.167	0.252	Q54WA7_DICDI RNA binding protein OS=Dictyostelium discoideum OX=44689 GN=pufA PE=4 SV=1
15	Q9ZW07	1.57e-128	420	968	0.159	0.195	PUM1_ARATH Pumilio homolog 1 OS=Arabidopsis thaliana OX=3702 GN=APUM1 PE=1 SV=1
16	Q9ZW02	3.17e-127	416	964	0.159	0.195	PUM3_ARATH Pumilio homolog 3 OS=Arabidopsis thaliana OX=3702 GN=APUM3 PE=1 SV=1
17	Q9ZW06	3.21e-126	414	972	0.159	0.193	PUM2_ARATH Pumilio homolog 2 OS=Arabidopsis thaliana OX=3702 GN=APUM2 PE=1 SV=1
18	Q9LJX4	8.21e-122	402	961	0.156	0.193	PUM5_ARATH Pumilio homolog 5 OS=Arabidopsis thaliana OX=3702 GN=APUM5 PE=1 SV=2
19	Q9SS47	3.57e-121	401	1003	0.164	0.193	PUM4_ARATH Pumilio homolog 4 OS=Arabidopsis thaliana OX=3702 GN=APUM4 PE=1 SV=2
20	O94462	6.26e-116	379	732	0.147	0.238	PUF3_SCHPO mRNA-binding protein puf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=puf3 PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16092 CFAP61_N	7.3e+02	11.2	Cilia- and flagella-associated protein 61, N-terminal domain
2	PF08144 CPL	1.6e+02	14.1	CPL (NUC119) domain
3	PF00806 PUF	3e-78	268.0	Pumilio-family RNA binding repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000391723

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000250863	0.899	Deleted in azoospermia-like
2	9606.ENSP00000355279	0.894	CCR4-NOT transcription complex subunit 7
3	9606.ENSP00000430493	0.888	CCR4-NOT transcription complex subunit 8
4	9606.ENSP00000261070	0.853	Cytochrome c oxidase copper chaperone
5	9606.ENSP00000320949	0.852	CCR4-NOT transcription complex subunit 1
6	9606.ENSP00000393275	0.844	Nanos homolog 1
7	9606.ENSP00000429824	0.826	Clathrin interactor 1
8	9606.ENSP00000341021	0.821	Nanos homolog 2
9	9606.ENSP00000373696	0.803	E3 ubiquitin-protein ligase TRIP12
10	9606.ENSP00000302913	0.800	SH3 domain-containing protein 19
11	9606.ENSP00000477715	0.779	Cytoplasmic polyadenylation element-binding protein 1
12	9606.ENSP00000478754	0.771	Probable ATP-dependent RNA helicase DDX6
13	9606.ENSP00000377486	0.751	Mitochondrial ribosomal protein L19
14	9606.ENSP00000341992	0.741	Nanos homolog 3
15	9606.ENSP00000397563	0.734	Poly(A) RNA polymerase GLD2
16	9606.ENSP00000454786	0.717	annotation not available
17	9606.ENSP00000362993	0.701	Protein bicaudal C homolog 1
18	9606.ENSP00000351159	0.700	CCR4-NOT transcription complex subunit 3
19	9606.ENSP00000377681	0.699	Ras GTPase-activating protein-binding protein 1
20	9606.ENSP00000313007	0.693	Polyadenylate-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003730	1.000	mRNA 3'-UTR binding
GO:0005515	0.998	protein binding
GO:0062104	0.317	pumilio-response element binding
GO:0106222	0.304	lncRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.975	regulation of biological process
GO:0010629	0.970	negative regulation of gene expression
GO:0009987	0.969	cellular process
GO:0048518	0.967	positive regulation of biological process
GO:0043488	0.967	regulation of mRNA stability
GO:0071704	0.956	organic substance metabolic process
GO:0044238	0.950	primary metabolic process
GO:0048522	0.944	positive regulation of cellular process
GO:0044237	0.930	cellular metabolic process
GO:0061157	0.916	mRNA destabilization
GO:0006807	0.902	nitrogen compound metabolic process
GO:0071840	0.862	cellular component organization or biogenesis
GO:0043170	0.842	macromolecule metabolic process
GO:0031047	0.831	RNA-mediated gene silencing
GO:0016070	0.824	RNA metabolic process
GO:0060147	0.709	regulation of post-transcriptional gene silencing
GO:0032502	0.662	developmental process
GO:0032501	0.650	multicellular organismal process
GO:0019953	0.577	sexual reproduction
GO:0003006	0.482	developmental process involved in reproduction
GO:0016043	0.477	cellular component organization
GO:0032504	0.460	multicellular organism reproduction
GO:0060966	0.436	regulation of gene silencing by RNA
GO:0048856	0.329	anatomical structure development
GO:0010467	0.315	gene expression
GO:0044085	0.312	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.999	cytosol
GO:0070013	0.999	intracellular organelle lumen
GO:0005654	0.994	nucleoplasm
GO:0043232	0.345	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]