StarFunc result for job id Q14674

User Input

>input (2120 residues)
MRSFKRVNFGTLLSSQKEAEELLPALKEFLSNPPAGFPSSRSDAERRQACDAILRACNQQ
LTAKLACPRHLGSLLELAELACDGYLVSTPQRPPLYLERILFVLLRNAAAQGSPEATLRL
AQPLHACLVQCSREAAPQDYEAVARGSFSLLWKGAEALLERRAAFAARLKALSFLVLLED
ESTPCEVPHFASPTACRAVAAHQLFDASGHGLNEADADFLDDLLSRHVIRALVGERGSSS
GLLSPQRALCLLELTLEHCRRFCWSRHHDKAISAVEKAHSYLRNTNLAPSLQLCQLGVKL
LQVGEEGPQAVAKLLIKASAVLSKSMEAPSPPLRALYESCQFFLSGLERGTKRRYRLDAI
LSLFAFLGGYCSLLQQLRDDGVYGGSSKQQQSFLQMYFQGLHLYTVVVYDFAQGCQIVDL
ADLTQLVDSCKSTVVWMLEALEGLSGQELTDHMGMTASYTSNLAYSFYSHKLYAEACAIS
EPLCQHLGLVKPGTYPEVPPEKLHRCFRLQVESLKKLGKQAQGCKMVILWLAALQPCSPE
HMAEPVTFWVRVKMDAARAGDKELQLKTLRDSLSGWDPETLALLLREELQAYKAVRADTG
QERFNIICDLLELSPEETPAGAWARATHLVELAQVLCYHDFTQQTNCSALDAIREALQLL
DSVRPEAQARDQLLDDKAQALLWLYICTLEAKMQEGIERDRRAQAPGNLEEFEVNDLNYE
DKLQEDRFLYSNIAFNLAADAAQSKCLDQALALWKELLTKGQAPAVRCLQQTAASLQILA
ALYQLVAKPMQALEVLLLLRIVSERLKDHSKAAGSSCHITQLLLTLGCPSYAQLHLEEAA
SSLKHLDQTTDTYLLLSLTCDLLRSQLYWTHQKVTKGVSLLLSVLRDPALQKSSKAWYLL
RVQVLQLVAAYLSLPSNNLSHSLWEQLCAQGWQTPEIALIDSHKLLRSIILLLMGSDILS
TQKAAVETSFLDYGENLVQKWQVLSEVLSCSEKLVCHLGRLGSVSEAKAFCLEALKLTTK
LQIPRQCALFLVLKGELELARNDIDLCQSDLQQVLFLLESCTEFGGVTQHLDSVKKVHLQ
KGKQQAQVPCPPQLPEEELFLRGPALELVATVAKEPGPIAPSTNSSPVLKTKPQPIPNFL
SHSPTCDCSLCASPVLTAVCLRWVLVTAGVRLAMGHQAQGLDLLQVVLKGCPEAAERLTQ
ALQASLNHKTPPSLVPSLLDEILAQAYTLLALEGLNQPSNESLQKVLQSGLKFVAARIPH
LEPWRASLLLIWALTKLGGLSCCTTQLFASSWGWQPPLIKSVPGSEPSKTQGQKRSGRGR
QKLASAPLRLNNTSQKGLEGRGLPCTPKPPDRIRQAGPHVPFTVFEEVCPTESKPEVPQA
PRVQQRVQTRLKVNFSDDSDLEDPVSAEAWLAEEPKRRGTASRGRGRARKGLSLKTDAVV
APGSAPGNPGLNGRSRRAKKVASRHCEERRPQRASDQARPGPEIMRTIPEEELTDNWRKM
SFEILRGSDGEDSASGGKTPAPGPEAASGEWELLRLDSSKKKLPSPCPDKESDKDLGPRL
RLPSAPVATGLSTLDSICDSLSVAFRGISHCPPSGLYAHLCRFLALCLGHRDPYATAFLV
TESVSITCRHQLLTHLHRQLSKAQKHRGSLEIADQLQGLSLQEMPGDVPLARIQRLFSFR
ALESGHFPQPEKESFQERLALIPSGVTVCVLALATLQPGTVGNTLLLTRLEKDSPPVSVQ
IPTGQNKLHLRSVLNEFDAIQKAQKENSSCTDKREWWTGRLALDHRMEVLIASLEKSVLG
CWKGLLLPSSEEPGPAQEASRLQELLQDCGWKYPDRTLLKIMLSGAGALTPQDIQALAYG
LCPTQPERAQELLNEAVGRLQGLTVPSNSHLVLVLDKDLQKLPWESMPSLQALPVTRLPS
FRFLLSYSIIKEYGASPVLSQGVDPRSTFYVLNPHNNLSSTEEQFRANFSSEAGWRGVVG
EVPRPEQVQEALTKHDLYIYAGHGAGARFLDGQAVLRLSCRAVALLFGCSSAALAVRGNL
EGAGIVLKYIMAGCPLFLGNLWDVTDRDIDRYTEALLQGWLGAGPGAPLLYYVNQARQAP
RLKYLIGAAPIAYGLPVSLR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7nj0A	0.535	0.948	0.000	1188	0.557	0.994	7nj0A.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
2	PDB:7nj1A	0.579	0.831	0.000	1448	0.676	0.990	7nj1A.pdb.gz
3	AFDB:P60330	0.850	0.851	0.000	2118	0.772	0.773	P60330.pdb.gz	ESPL1_MOUSE Separin OS=Mus musculus OX=10090 GN=Espl1 PE=1 SV=1
4	AFDB:Q14674	1.000	1.000	0.000	2120	1.000	1.000	Q14674.pdb.gz	ESPL1_HUMAN Separin OS=Homo sapiens OX=9606 GN=ESPL1 PE=1 SV=3
5	PDB:5u1sA	0.352	0.471	7.993E-23	1488	0.118	0.169	5u1sA.pdb.gz
6	PDB:5mz61	0.398	0.781	1.959E-20	1018	0.091	0.190	5mz61.pdb.gz
7	PDB:7n6g1N	0.242	0.239	1.717E-12	2179	0.138	0.134	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
8	PDB:7sqcR1	0.206	0.209	6.308E-12	2080	0.130	0.132	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
9	PDB:4bujB	0.135	0.176	2.086E-8	1367	0.071	0.110	4bujB.pdb.gz
10	AFDB:E1C2U2	0.122	0.114	2.121E-8	2326	0.095	0.087	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
11	AFDB:F4J8G7	0.070	0.070	2.554E-8	2138	0.102	0.101	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
12	AFDB:Q5UIP0	0.116	0.106	5.175E-8	2472	0.095	0.081	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
13	AFDB:Q6PR54	0.109	0.099	8.084E-8	2419	0.087	0.076	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
14	AFDB:F4IAT2	0.090	0.098	9.380E-8	1823	0.092	0.106	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
15	PDB:7dkhI	0.132	0.208	7.677E-7	914	0.055	0.128	7dkhI.pdb.gz
16	PDB:7qdrB	0.121	0.181	1.676E-6	1212	0.078	0.137	7qdrB.pdb.gz
17	PDB:7sicA	0.073	0.061	5.714E-6	2773	0.093	0.071	7sicA.pdb.gz	Structure of the human ATM kinase and mechanism of Nbs1 binding.
18	AFDB:Q9VW47	0.077	0.068	1.268E-5	2531	0.102	0.086	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
19	AFDB:Q9VWE6	0.065	0.065	5.622E-4	2111	0.072	0.072	Q9VWE6.pdb.gz	ELYS_DROME Protein ELYS homolog OS=Drosophila melanogaster OX=7227 GN=Elys PE=1 SV=2
20	AFDB:Q9CXB8	0.102	0.159	9.115E-4	1231	0.059	0.102	Q9CXB8.pdb.gz	ALPK1_MOUSE Alpha-protein kinase 1 OS=Mus musculus OX=10090 GN=Alpk1 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P60330	0.0	3217	2118	0.773	0.774	ESPL1_MOUSE Separin OS=Mus musculus OX=10090 GN=Espl1 PE=1 SV=1
2	Q14674	0.0	4293	2120	1.000	1.000	ESPL1_HUMAN Separin OS=Homo sapiens OX=9606 GN=ESPL1 PE=1 SV=3
3	P18296	9.68e-44	178	1828	0.063	0.073	CUT1_SCHPO Separin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut1 PE=1 SV=3
4	G0SHM3	1.25e-43	178	2223	0.070	0.067	G0SHM3_CHATD separase OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) OX=759272 GN=CTHT_0070540 PE=1 SV=1
5	Q03018	2.70e-41	170	1630	0.057	0.074	ESP1_YEAST Separin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESP1 PE=1 SV=2
6	Q5IBC5	7.45e-40	166	2180	0.050	0.049	ESP1_ARATH Separase OS=Arabidopsis thaliana OX=3702 GN=ESP1 PE=2 SV=1
7	G5ED39	1.51e-33	144	1262	0.057	0.095	SEP1_CAEEL Separin homolog sep-1 OS=Caenorhabditis elegans OX=6239 GN=sep-1 PE=1 SV=1
8	A0A1D8PCM0	5.85e-29	129	1598	0.039	0.052	A0A1D8PCM0_CANAL separase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ESP1 PE=4 SV=1
9	Q9VRN6	1.94e-14	81.3	634	0.034	0.115	Q9VRN6_DROME separase OS=Drosophila melanogaster OX=7227 GN=Sse PE=2 SV=1
10	Q4GYR1	8.03e-14	80.1	1159	0.033	0.061	Q4GYR1_TRYB2 separase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3120 PE=4 SV=1
11	P27124	1.7	35.8	458	0.012	0.057	FKBP4_RABIT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Oryctolagus cuniculus OX=9986 GN=FKBP4 PE=1 SV=3
12	Q9QVC8	1.8	35.8	458	0.012	0.057	FKBP4_RAT Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Rattus norvegicus OX=10116 GN=Fkbp4 PE=1 SV=3
13	Q9TRY0	1.8	35.8	459	0.012	0.057	FKBP4_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Bos taurus OX=9913 GN=FKBP4 PE=1 SV=4
14	P30416	2.0	35.8	458	0.012	0.057	FKBP4_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Mus musculus OX=10090 GN=Fkbp4 PE=1 SV=5
15	Q8K2Z4	3.0	35.4	1392	0.010	0.016	CND1_MOUSE Condensin complex subunit 1 OS=Mus musculus OX=10090 GN=Ncapd2 PE=1 SV=2
16	Q9P7S2	4.5	34.7	421	0.018	0.093	RPN6_SCHPO Probable 26S proteasome regulatory subunit rpn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn6 PE=3 SV=1
17	Q5SUR0	4.6	35.0	1337	0.017	0.026	PUR4_MOUSE Phosphoribosylformylglycinamidine synthase OS=Mus musculus OX=10090 GN=Pfas PE=1 SV=1
18	Q9U9R7	9.7	33.1	324	0.011	0.074	SNAG_DICDI Gamma-soluble NSF attachment protein OS=Dictyostelium discoideum OX=44689 GN=snpC PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12770 CHAT	5.4	18.0	CHAT domain
2	PF03568 Peptidase_C50	1.4e-87	306.1	Peptidase family C50

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000257934

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377536	0.999	Securin
2	9606.ENSP00000256442	0.996	G2/mitotic-specific cyclin-B1
3	9606.ENSP00000354720	0.996	Structural maintenance of chromosomes protein 3
4	9606.ENSP00000297338	0.995	Double-strand-break repair protein rad21 homolog
5	9606.ENSP00000361540	0.993	Cell division cycle protein 20 homolog
6	9606.ENSP00000378699	0.992	Cyclin-dependent kinase 1
7	9606.ENSP00000302530	0.990	Mitotic checkpoint serine/threonine-protein kinase BUB1
8	9606.ENSP00000287598	0.987	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
9	9606.ENSP00000482546	0.985	Meiotic recombination protein REC8 homolog
10	9606.ENSP00000260731	0.984	Kinesin-like protein KIF11
11	9606.ENSP00000313950	0.983	Aurora kinase B
12	9606.ENSP00000358813	0.982	Dual specificity protein kinase TTK
13	9606.ENSP00000288207	0.981	G2/mitotic-specific cyclin-B2
14	9606.ENSP00000300093	0.981	Serine/threonine-protein kinase PLK1
15	9606.ENSP00000218089	0.978	Cohesin subunit SA-2
16	9606.ENSP00000323421	0.977	Structural maintenance of chromosomes protein 1A
17	9606.ENSP00000350036	0.976	Structural maintenance of chromosomes protein 1B
18	9606.ENSP00000411532	0.976	DNA topoisomerase 2-alpha
19	9606.ENSP00000372689	0.973	Cohesin subunit SA-1
20	9606.ENSP00000261597	0.966	Kinetochore protein NDC80 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008234	1.000	cysteine-type peptidase activity
GO:0005515	0.999	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0016043	0.932	cellular component organization
GO:1903047	0.907	mitotic cell cycle process
GO:0006996	0.856	organelle organization
GO:0051276	0.846	chromosome organization
GO:0000070	0.791	mitotic sister chromatid segregation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005813	0.998	centrosome
GO:0031981	0.966	nuclear lumen
GO:0005654	0.783	nucleoplasm
GO:0032991	0.455	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).

[back to server]