StarFunc result for job id Q14676

User Input

>input (2089 residues)
MEDTQAIDWDVEEEEETEQSSESLRCNVEPVGRLHIFSGAHGPEKDFPLHLGKNVVGRMP
DCSVALPFPSISKQHAEIEILAWDKAPILRDCGSLNGTQILRPPKVLSPGVSHRLRDQEL
ILFADLLCQYHRLDVSLPFVSRGPLTVEETPRVQGETQPQRLLLAEDSEEEVDFLSERRM
VKKSRTTSSSVIVPESDEEGHSPVLGGLGPPFAFNLNSDTDVEEGQQPATEEASSAARRG
ATVEAKQSEAEVVTEIQLEKDQPLVKERDNDTKVKRGAGNGVVPAGVILERSQPPGEDSD
TDVDDDSRPPGRPAEVHLERAQPFGFIDSDTDAEEERIPATPVVIPMKKRKIFHGVGTRG
PGAPGLAHLQESQAGSDTDVEEGKAPQAVPLEKSQASMVINSDTDDEEEVSAALTLAHLK
ESQPAIWNRDAEEDMPQRVVLLQRSQTTTERDSDTDVEEEELPVENREAVLKDHTKIRAL
VRAHSEKDQPPFGDSDDSVEADKSSPGIHLERSQASTTVDINTQVEKEVPPGSAIIHIKK
HQVSVEGTNQTDVKAVGGPAKLLVVSLEEAWPLHGDCETDAEEGTSLTASVVADVRKSQL
PAEGDAGAEWAAAVLKQERAHEVGAQGGPPVAQVEQDLPISRENLTDLVVDTDTLGESTQ
PQREGAQVPTGREREQHVGGTKDSEDNYGDSEDLDLQATQCFLENQGLEAVQSMEDEPTQ
AFMLTPPQELGPSHCSFQTTGTLDEPWEVLATQPFCLRESEDSETQPFDTHLEAYGPCLS
PPRAIPGDQHPESPVHTEPMGIQGRGRQTVDKVMGIPKETAERVGPERGPLERETEKLLP
ERQTDVTGEEELTKGKQDREQKQLLARDTQRQESDKNGESASPERDRESLKVEIETSEEI
QEKQVQKQTLPSKAFEREVERPVANRECDPAELEEKVPKVILERDTQRGEPEGGSQDQKG
QASSPTPEPGVGAGDLPGPTSAPVPSGSQSGGRGSPVSPRRHQKGLLNCKMPPAEKASRI
RAAEKVSRGDQESPDACLPPTVPEAPAPPQKPLNSQSQKHLAPPPLLSPLLPSIKPTVRK
TRQDGSQEAPEAPLSSELEPFHPKPKIRTRKSSRMTPFPATSAAPEPHPSTSTAQPVTPK
PTSQATRSRTNRSSVKTPEPVVPTAPELQPSTSTDQPVTSEPTSQVTRGRKSRSSVKTPE
TVVPTALELQPSTSTDRPVTSEPTSQATRGRKNRSSVKTPEPVVPTAPELQPSTSTDQPV
TSEPTYQATRGRKNRSSVKTPEPVVPTAPELRPSTSTDRPVTPKPTSRTTRSRTNMSSVK
TPETVVPTAPELQISTSTDQPVTPKPTSRTTRSRTNMSSVKNPESTVPIAPELPPSTSTE
QPVTPEPTSRATRGRKNRSSGKTPETLVPTAPKLEPSTSTDQPVTPEPTSQATRGRTNRS
SVKTPETVVPTAPELQPSTSTDQPVTPEPTSQATRGRTDRSSVKTPETVVPTAPELQASA
STDQPVTSEPTSRTTRGRKNRSSVKTPETVVPAAPELQPSTSTDQPVTPEPTSRATRGRT
NRSSVKTPESIVPIAPELQPSTSRNQLVTPEPTSRATRCRTNRSSVKTPEPVVPTAPEPH
PTTSTDQPVTPKLTSRATRRKTNRSSVKTPKPVEPAASDLEPFTPTDQSVTPEAIAQGGQ
SKTLRSSTVRAMPVPTTPEFQSPVTTDQPISPEPITQPSCIKRQRAAGNPGSLAAPIDHK
PCSAPLEPKSQASRNQRWGAVRAAESLTAIPEPASPQLLETPIHASQIQKVEPAGRSRFT
PELQPKASQSRKRSLATMDSPPHQKQPQRGEVSQKTVIIKEEEEDTAEKPGKEEDVVTPK
PGKRKRDQAEEEPNRIPSRSLRRTKLNQESTAPKVLFTGVVDARGERAVLALGGSLAGSA
AEASHLVTDRIRRTVKFLCALGRGIPILSLDWLHQSRKAGFFLPPDEYVVTDPEQEKNFG
FSLQDALSRARERRLLEGYEIYVTPGVQPPPPQMGEIISCCGGTYLPSMPRSYKPQRVVI
TCPQDFPHCSIPLRVGLPLLSPEFLLTGVLKQEAKPEAFVLSPLEMSST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14676	1.000	1.000	0.000	2089	1.000	1.000	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
2	AFDB:Q5PSV9	0.108	0.131	0.000	1707	0.490	0.600	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
3	AFDB:Q95RC8	0.088	0.141	3.710E-12	1280	0.101	0.166	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
4	AFDB:P38398	0.083	0.093	5.144E-10	1863	0.123	0.137	P38398.pdb.gz	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2
5	AFDB:P48754	0.096	0.110	1.159E-9	1812	0.131	0.151	P48754.pdb.gz	BRCA1_MOUSE Breast cancer type 1 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca1 PE=1 SV=3
6	AFDB:O96685	0.085	0.139	2.767E-9	1261	0.090	0.149	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
7	AFDB:Q9VUB7	0.094	0.086	7.420E-9	2294	0.124	0.112	Q9VUB7.pdb.gz	Q9VUB7_DROME PAX transcription activation domain interacting protein OS=Drosophila melanogaster OX=7227 GN=Ptip PE=1 SV=3
8	AFDB:Q6A065	0.053	0.067	1.578E-8	1588	0.116	0.152	Q6A065.pdb.gz	CE170_MOUSE Centrosomal protein of 170 kDa OS=Mus musculus OX=10090 GN=Cep170 PE=1 SV=2
9	AFDB:Q5SW79	0.053	0.067	3.992E-8	1584	0.123	0.162	Q5SW79.pdb.gz	CE170_HUMAN Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1
10	AFDB:B7SY83	0.048	0.066	3.620E-7	1477	0.103	0.146	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
11	PDB:2ff4A	0.044	0.231	4.993E-7	379	0.011	0.061	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
12	PDB:7dvqX	0.048	0.530	7.202E-6	156	0.013	0.173	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:2kb3A	0.045	0.566	1.445E-5	143	0.011	0.154	2kb3A.pdb.gz
14	PDB:5z56X	0.047	0.515	4.611E-5	159	0.011	0.138	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
15	PDB:5gm6U	0.047	0.484	1.751E-4	176	0.011	0.136	5gm6U.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:2kfuA	0.048	0.486	3.946E-4	162	0.015	0.198	2kfuA.pdb.gz
17	PDB:7lsyY	0.039	0.090	1.188E-3	855	0.012	0.030	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
18	PDB:7wrgA	0.043	0.106	1.890E-3	812	0.010	0.026	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
19	PDB:6l9wD	0.036	0.459	1.142E-2	142	0.004	0.063	6l9wD.pdb.gz
20	PDB:7wrgB	0.040	0.102	1.440E-2	783	0.010	0.026	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1U9XBC1	0.0	4151	2089	1.000	1.000	A0A1U9XBC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 PE=4 SV=1
2	Q14676	0.0	4151	2089	1.000	1.000	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
3	Q5PSV9	0.0	1169	1707	0.379	0.463	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
4	Q6ZW49	6.14e-24	113	1069	0.031	0.060	PAXI1_HUMAN PAX-interacting protein 1 OS=Homo sapiens OX=9606 GN=PAXIP1 PE=1 SV=2
5	Q6NZQ4	4.31e-23	110	1056	0.033	0.064	PAXI1_MOUSE PAX-interacting protein 1 OS=Mus musculus OX=10090 GN=Paxip1 PE=1 SV=1
6	Q9VUB7	4.21e-19	97.8	2294	0.032	0.029	Q9VUB7_DROME PAX transcription activation domain interacting protein OS=Drosophila melanogaster OX=7227 GN=Ptip PE=1 SV=3
7	Q9U370	4.42e-12	74.3	1076	0.022	0.043	Q9U370_CAEEL BRCT domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=pis-1 PE=1 SV=1
8	Q10337	5.18e-12	73.9	878	0.022	0.054	BRC1_SCHPO BRCT-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brc1 PE=1 SV=1
9	Q9W061	9.61e-07	56.6	1259	0.014	0.024	Q9W061_DROME Mutator 2, isoform B OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
10	A2VEF9	1.07e-06	56.6	1274	0.014	0.024	A2VEF9_DROME IP15561p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
11	Q95RC8	1.11e-06	56.6	1280	0.014	0.023	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
12	Q13585	1.58e-06	55.8	617	0.029	0.099	MTR1L_HUMAN Melatonin-related receptor OS=Homo sapiens OX=9606 GN=GPR50 PE=1 SV=3
13	E9PVX6	0.001	47.0	3177	0.014	0.009	KI67_MOUSE Proliferation marker protein Ki-67 OS=Mus musculus OX=10090 GN=Mki67 PE=1 SV=1
14	D4A0Y6	0.004	45.1	3121	0.011	0.007	D4A0Y6_RAT Marker of proliferation Ki-67 OS=Rattus norvegicus OX=10116 GN=Mki67 PE=1 SV=3
15	Q008X6	0.056	41.2	6872	0.019	0.006	R1AB_WBV24 Replicase polyprotein 1ab OS=White bream virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 GN=rep PE=1 SV=1
16	A5YTR9	0.22	39.3	981	0.011	0.024	A5YTR9_DROME IP08064p OS=Drosophila melanogaster OX=7227 GN=MCPH1 PE=1 SV=1
17	E1JH39	0.24	38.9	1028	0.011	0.023	E1JH39_DROME Microcephalin, isoform D OS=Drosophila melanogaster OX=7227 GN=MCPH1 PE=1 SV=1
18	G4SLH0	1.5	36.6	18562	0.063	0.007	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
19	Q57ZI4	2.4	35.8	973	0.029	0.063	Q57ZI4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.260 PE=4 SV=1
20	Q9QZM6	4.1	35.0	1181	0.031	0.054	NCKX1_RAT Sodium/potassium/calcium exchanger 1 OS=Rattus norvegicus OX=10116 GN=Slc24a1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	3.6	19.3	BRCA1 C Terminus (BRCT) domain
2	PF00498 FHA	4.8e-07	41.4	FHA domain
3	PF16770 RTT107_BRCT_5	0.0032	28.7	Regulator of Ty1 transposition protein 107 BRCT domain
4	PF16697 Yop-YscD_cpl	35	16.1	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365588

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265433	0.999	Nibrin
2	9606.ENSP00000278616	0.999	Serine-protein kinase ATM
3	9606.ENSP00000362578	0.999	E3 ubiquitin-protein ligase RNF8
4	9606.ENSP00000371475	0.999	TP53-binding protein 1
5	9606.ENSP00000418960	0.999	Breast cancer type 1 susceptibility protein
6	9606.ENSP00000434024	0.999	Histone H2AX
7	9606.ENSP00000260810	0.997	DNA topoisomerase 2-binding protein 1
8	9606.ENSP00000366434	0.997	BRCA1-A complex subunit RAP80
9	9606.ENSP00000372023	0.996	Serine/threonine-protein kinase Chk2
10	9606.ENSP00000325863	0.993	Double-strand break repair protein MRE11
11	9606.ENSP00000368100	0.993	DNA repair protein RAD50
12	9606.ENSP00000287647	0.985	Fanconi anemia group D2 protein
13	9606.ENSP00000426503	0.985	E3 ubiquitin-protein ligase RNF4
14	9606.ENSP00000372351	0.981	Histone-lysine N-methyltransferase NSD2
15	9606.ENSP00000388648	0.981	Serine/threonine-protein kinase Chk1
16	9606.ENSP00000343741	0.980	Serine/threonine-protein kinase ATR
17	9606.ENSP00000316176	0.976	Ubiquitin-conjugating enzyme E2 N
18	9606.ENSP00000369857	0.975	BRCA1-A complex subunit Abraxas 1
19	9606.ENSP00000313420	0.970	DNA-dependent protein kinase catalytic subunit
20	9606.ENSP00000382628	0.970	DNA endonuclease RBBP8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070975	1.000	FHA domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050789	0.996	regulation of biological process
GO:0050896	0.994	response to stimulus
GO:0050794	0.994	regulation of cellular process
GO:0051716	0.984	cellular response to stimulus
GO:0010564	0.967	regulation of cell cycle process
GO:0006974	0.959	cellular response to DNA damage stimulus
GO:0048523	0.950	negative regulation of cellular process
GO:1901987	0.917	regulation of cell cycle phase transition
GO:0000077	0.907	DNA damage checkpoint signaling
GO:0007093	0.895	mitotic cell cycle checkpoint signaling
GO:0044774	0.891	mitotic DNA integrity checkpoint signaling
GO:0044773	0.792	mitotic DNA damage checkpoint signaling
GO:0071704	0.645	organic substance metabolic process
GO:0043170	0.586	macromolecule metabolic process
GO:0006807	0.582	nitrogen compound metabolic process
GO:0019222	0.527	regulation of metabolic process
GO:0060255	0.522	regulation of macromolecule metabolic process
GO:0044237	0.514	cellular metabolic process
GO:0051171	0.446	regulation of nitrogen compound metabolic process
GO:0044238	0.417	primary metabolic process
GO:0034641	0.386	cellular nitrogen compound metabolic process
GO:0080090	0.335	regulation of primary metabolic process
GO:0006139	0.324	nucleobase-containing compound metabolic process
GO:0090304	0.308	nucleic acid metabolic process
GO:0044260	0.302	cellular macromolecule metabolic process
GO:0048518	0.301	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016604	1.000	nuclear body
GO:0005925	0.999	focal adhesion
GO:0005737	0.763	cytoplasm
GO:0043232	0.730	intracellular non-membrane-bounded organelle
GO:0032991	0.510	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]