StarFunc result for job id Q14678

User Input

>input (1352 residues)
MAHTTKVNGSASGKAGDILSGDQDKEQKDPYFVETPYGYQLDLDFLKYVDDIQKGNTIKR
LNIQKRRKPSVPCPEPRTTSGQQGIWTSTESLSSSNSDDNKQCPNFLIARSQVTSTPISK
PPPPLETSLPFLTIPENRQLPPPSPQLPKHNLHVTKTLMETRRRLEQERATMQMTPGEFR
RPRLASFGGMGTTSSLPSFVGSGNHNPAKHQLQNGYQGNGDYGSYAPAAPTTSSMGSSIR
HSPLSSGISTPVTNVSPMHLQHIREQMAIALKRLKELEEQVRTIPVLQVKISVLQEEKRQ
LVSQLKNQRAASQINVCGVRKRSYSAGNASQLEQLSRARRSGGELYIDYEEEEMETVEQS
TQRIKEFRQLTADMQALEQKIQDSSCEASSELRENGECRSVAVGAEENMNDIVVYHRGSR
SCKDAAVGTLVEMRNCGVSVTEAMLGVMTEADKEIELQQQTIESLKEKIYRLEVQLRETT
HDREMTKLKQELQAAGSRKKVDKATMAQPLVFSKVVEAVVQTRDQMVGSHMDLVDTCVGT
SVETNSVGISCQPECKNKVVGPELPMNWWIVKERVEMHDRCAGRSVEMCDKSVSVEVSVC
ETGSNTEESVNDLTLLKTNLNLKEVRSIGCGDCSVDVTVCSPKECASRGVNTEAVSQVEA
AVMAVPRTADQDTSTDLEQVHQFTNTETATLIESCTNTCLSTLDKQTSTQTVETRTVAVG
EGRVKDINSSTKTRSIGVGTLLSGHSGFDRPSAVKTKESGVGQININDNYLVGLKMRTIA
CGPPQLTVGLTASRRSVGVGDDPVGESLENPQPQAPLGMMTGLDHYIERIQKLLAEQQTL
LAENYSELAEAFGEPHSQMGSLNSQLISTLSSINSVMKSASTEELRNPDFQKTSLGKITG
NYLGYTCKCGGLQSGSPLSSQTSQPEQEVGTSEGKPISSLDAFPTQEGTLSPVNLTDDQI
AAGLYACTNNESTLKSIMKKKDGNKDSNGAKKNLQFVGINGGYETTSSDDSSSDESSSSE
SDDECDVIEYPLEEEEEEEDEDTRGMAEGHHAVNIEGLKSARVEDEMQVQECEPEKVEIR
ERYELSEKMLSACNLLKNTINDPKALTSKDMRFCLNTLQHEWFRVSSQKSAIPAMVGDYI
AAFEAISPDVLRYVINLADGNGNTALHYSVSHSNFEIVKLLLDADVCNVDHQNKAGYTPI
MLAALAAVEAEKDMRIVEELFGCGDVNAKASQAGQTALMLAVSHGRIDMVKGLLACGADV
NIQDDEGSTALMCASEHGHVEIVKLLLAQPGCNGHLEDNDGSTALSIALEAGHKDIAVLL
YAHVNFAKAQSPGTPRLGRKTSPGPTHRGSFD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14678	1.000	1.000	0.000	1352	1.000	1.000	Q14678.pdb.gz	KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=KANK1 PE=1 SV=3
2	PDB:8cs9A	0.126	0.204	1.519E-9	796	0.043	0.073	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
3	PDB:2dvwA	0.127	0.641	3.082E-9	229	0.047	0.279	2dvwA.pdb.gz
4	PDB:4oauC	0.111	0.209	4.390E-9	692	0.050	0.098	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
5	PDB:1wg0A	0.128	0.606	4.857E-9	243	0.045	0.251	1wg0A.pdb.gz
6	PDB:1bu9A	0.116	0.837	2.574E-8	168	0.033	0.268	1bu9A.pdb.gz
7	PDB:1bd8A	0.105	0.804	6.723E-8	156	0.032	0.276	1bd8A.pdb.gz
8	AFDB:A0A140LI88	0.088	0.066	9.246E-8	1857	0.139	0.101	A0A140LI88.pdb.gz	ANR31_MOUSE Ankyrin repeat domain-containing protein 31 OS=Mus musculus OX=10090 GN=Ankrd31 PE=1 SV=2
9	PDB:5vkqA	0.117	0.107	3.387E-7	1499	0.045	0.041	5vkqA.pdb.gz
10	PDB:6mwqA	0.106	0.282	3.563E-7	493	0.041	0.114	6mwqA.pdb.gz
11	PDB:6jd6B	0.115	0.727	4.146E-7	192	0.033	0.229	6jd6B.pdb.gz
12	AFDB:Q8CGN4	0.094	0.075	1.346E-6	1759	0.141	0.108	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
13	PDB:6v9hC	0.117	0.525	2.089E-6	270	0.028	0.141	6v9hC.pdb.gz
14	AFDB:Q5H9F3	0.091	0.078	1.016E-5	1711	0.143	0.113	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
15	AFDB:Q6W2J9	0.091	0.074	5.120E-5	1755	0.146	0.113	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
16	AFDB:A0A0B4K682	0.053	0.054	1.337E-4	1315	0.113	0.116	A0A0B4K682.pdb.gz	A0A0B4K682_DROME Javelin-like, isoform D OS=Drosophila melanogaster OX=7227 GN=jvl PE=4 SV=1
17	AFDB:Q8IQT4	0.097	0.064	6.406E-4	2133	0.147	0.093	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
18	AFDB:F1RCL8	0.102	0.080	1.175E-3	1796	0.131	0.099	F1RCL8.pdb.gz	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
19	AFDB:Q9W517	0.062	0.051	1.300E-3	1741	0.121	0.094	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
20	AFDB:Q55DL8	0.062	0.055	2.266E-3	1574	0.141	0.121	Q55DL8.pdb.gz	Q55DL8_DICDI C2H2-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=gxcT PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14678	0.0	2804	1352	1.000	1.000	KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=KANK1 PE=1 SV=3
2	Q63ZY3	1.07e-97	335	851	0.135	0.214	KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1
3	D3ZD05	6.24e-95	327	847	0.135	0.215	KANK2_RAT KN motif and ankyrin repeat domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Kank2 PE=1 SV=2
4	X1WE18	3.42e-94	330	1085	0.115	0.143	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
5	Q8BX02	1.32e-93	323	843	0.124	0.199	KANK2_MOUSE KN motif and ankyrin repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Kank2 PE=1 SV=1
6	Q5T7N3	1.37e-93	327	995	0.134	0.182	KANK4_HUMAN KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KANK4 PE=1 SV=1
7	A0A0B4JD77	5.54e-72	250	446	0.088	0.267	A0A0B4JD77_DROME Kank, isoform J OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
8	A1Z9W7	3.04e-69	256	1042	0.087	0.113	A1Z9W7_DROME Kank, isoform B OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
9	A0A0B4KF63	3.98e-69	255	1039	0.087	0.114	A0A0B4KF63_DROME Kank, isoform I OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
10	A0A0B4JD54	4.26e-69	256	1063	0.087	0.111	A0A0B4JD54_DROME Kank, isoform F OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
11	Q5BIA1	1.93e-68	255	1301	0.088	0.091	Q5BIA1_DROME RE07880p OS=Drosophila melanogaster OX=7227 GN=Kank PE=2 SV=1
12	Q7KMM8	3.04e-68	254	1224	0.087	0.096	Q7KMM8_DROME BcDNA.GH03482 OS=Drosophila melanogaster OX=7227 GN=Kank PE=2 SV=1
13	A0A0B4JCT6	4.78e-68	254	1294	0.087	0.091	A0A0B4JCT6_DROME Kank, isoform G OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
14	A8DYE0	6.51e-68	254	1339	0.087	0.088	A8DYE0_DROME Kank, isoform D OS=Drosophila melanogaster OX=7227 GN=Kank PE=2 SV=1
15	A1Z9W5	7.63e-68	253	1301	0.087	0.091	A1Z9W5_DROME Kank, isoform C OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
16	G5EDN8	7.46e-64	239	1040	0.084	0.109	G5EDN8_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-19 PE=1 SV=1
17	E1JH70	7.00e-31	134	934	0.046	0.066	E1JH70_DROME Kank, isoform E OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
18	A0A0R4IUB2	2.82e-17	90.9	2580	0.046	0.024	A0A0R4IUB2_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=2
19	E9QEX9	2.90e-17	90.9	2607	0.046	0.024	E9QEX9_DANRE Ankyrin repeat and KH domain-containing 1 OS=Danio rerio OX=7955 GN=ankhd1 PE=1 SV=1
20	A0A0G2K916	9.12e-17	89.4	2615	0.046	0.024	A0A0G2K916_RAT Eukaryotic translation initiation factor 4E binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ankhd1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.3e-19	80.9	Ankyrin repeat
2	PF12796 Ank_2	7.4e-25	98.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	7.7e-16	67.5	Ankyrin repeat
4	PF13637 Ank_4	2.5e-17	74.3	Ankyrin repeats (many copies)
5	PF13857 Ank_5	3.2e-19	80.0	Ankyrin repeats (many copies)
6	PF08181 DegQ	4.8e+02	12.3	DegQ (SacQ) family
7	PF12075 KN_motif	5.9e-17	72.5	KN motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477725

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354878	0.998	Kinesin-like protein KIF21A
2	9606.ENSP00000302543	0.914	CXXC-type zinc finger protein 5
3	9606.ENSP00000394888	0.904	Dedicator of cytokinesis protein 8
4	9606.ENSP00000371711	0.820	Doublesex- and mab-3-related transcription factor 1
5	9606.ENSP00000371535	0.769	O-phosphoseryl-tRNA(Sec) selenium transferase
6	9606.ENSP00000314724	0.749	Liprin-beta-1
7	9606.ENSP00000405405	0.728	Pleckstrin homology-like domain family B member 2
8	9606.ENSP00000352603	0.727	AP-4 complex subunit mu-1
9	9606.ENSP00000453508	0.724	Talin-2
10	9606.ENSP00000253925	0.683	Liprin-alpha-1
11	9606.ENSP00000379658	0.616	Transcription factor ETV6
12	9606.ENSP00000190165	0.613	Doublesex- and mab-3-related transcription factor 3
13	9606.ENSP00000267012	0.610	Bridging integrator 2
14	9606.ENSP00000263923	0.609	Vascular endothelial growth factor receptor 2
15	9606.ENSP00000349305	0.606	Golgin subfamily A member 4
16	9606.ENSP00000350928	0.603	Glutamate decarboxylase 1
17	9606.ENSP00000316338	0.592	Brain-specific angiogenesis inhibitor 1-associated protein 2
18	9606.ENSP00000334538	0.585	Splicing regulatory glutamine/lysine-rich protein 1
19	9606.ENSP00000359990	0.581	Leucine-rich repeat-containing protein 40
20	9606.ENSP00000356448	0.555	Nucleoprotein TPR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008013	1.000	beta-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.984	regulation of cellular process
GO:0048519	0.975	negative regulation of biological process
GO:0009966	0.968	regulation of signal transduction
GO:0048518	0.964	positive regulation of biological process
GO:0048523	0.959	negative regulation of cellular process
GO:0051128	0.954	regulation of cellular component organization
GO:0048522	0.953	positive regulation of cellular process
GO:0032501	0.946	multicellular organismal process
GO:0030155	0.918	regulation of cell adhesion
GO:0016043	0.895	cellular component organization
GO:1902903	0.886	regulation of supramolecular fiber organization
GO:0032970	0.880	regulation of actin filament-based process
GO:0040012	0.867	regulation of locomotion
GO:0044087	0.864	regulation of cellular component biogenesis
GO:2000145	0.843	regulation of cell motility
GO:1902531	0.837	regulation of intracellular signal transduction
GO:0033043	0.836	regulation of organelle organization
GO:0051493	0.828	regulation of cytoskeleton organization
GO:0060491	0.825	regulation of cell projection assembly
GO:0010810	0.822	regulation of cell-substrate adhesion
GO:0120032	0.822	regulation of plasma membrane bounded cell projection assembly
GO:0032956	0.808	regulation of actin cytoskeleton organization
GO:0016477	0.795	cell migration
GO:0065008	0.777	regulation of biological quality
GO:0050793	0.761	regulation of developmental process
GO:0110053	0.757	regulation of actin filament organization
GO:0048585	0.746	negative regulation of response to stimulus
GO:2000114	0.742	regulation of establishment of cell polarity
GO:1902904	0.711	negative regulation of supramolecular fiber organization
GO:0006996	0.707	organelle organization
GO:0051056	0.688	regulation of small GTPase mediated signal transduction
GO:0046578	0.673	regulation of Ras protein signal transduction
GO:0090130	0.672	tissue migration
GO:1902743	0.623	regulation of lamellipodium organization
GO:0043254	0.622	regulation of protein-containing complex assembly
GO:0022603	0.619	regulation of anatomical structure morphogenesis
GO:0032271	0.585	regulation of protein polymerization
GO:1900076	0.572	regulation of cellular response to insulin stimulus
GO:0009968	0.566	negative regulation of signal transduction
GO:0008064	0.554	regulation of actin polymerization or depolymerization
GO:0046626	0.520	regulation of insulin receptor signaling pathway
GO:1900077	0.516	negative regulation of cellular response to insulin stimulus
GO:0007010	0.472	cytoskeleton organization
GO:0048584	0.443	positive regulation of response to stimulus
GO:0051058	0.426	negative regulation of small GTPase mediated signal transduction
GO:0031345	0.413	negative regulation of cell projection organization
GO:0030334	0.379	regulation of cell migration
GO:0010639	0.373	negative regulation of organelle organization
GO:0050896	0.365	response to stimulus
GO:0090132	0.326	epithelium migration
GO:0048856	0.316	anatomical structure development
GO:0040013	0.312	negative regulation of locomotion
GO:0010812	0.309	negative regulation of cell-substrate adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	0.997	plasma membrane
GO:0005634	0.996	nucleus
GO:0120025	0.869	plasma membrane bounded cell projection
GO:0005829	0.829	cytosol
GO:0031252	0.809	cell leading edge
GO:0032587	0.767	ruffle membrane
GO:0043232	0.740	intracellular non-membrane-bounded organelle
GO:0070161	0.555	anchoring junction
GO:0030055	0.371	cell-substrate junction
GO:0005856	0.308	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]