StarFunc result for job id Q14679

User Input

>input (1199 residues)
MASAGTQHYSIGLRQKNSFKQSGPSGTVPATPPEKPSEGRVWPQAHQQVKPIWKLEKKQV
ETLSAGLGPGLLGVPPQPAYFFCPSTLCSSGTTAVIAGHSSSCYLHSLPDLFNSTLLYRR
SSYRQKPYQQLESFCLRSSPSEKSPFSLPQKSLPVSLTANKATSSMVFSMAQPMASSSTE
PYLCLAAAGENPSGKSLASAISGKIPSPLSSSYKPMLNNNSFMWPNSTPVPLLQTTQGLK
PVSPPKIQPVSWHHSGGTGDCAPQPVDHKVPKSIGTVPADASAHIALSTASSHDTSTTSV
ASSWYNRNNLAMRAEPLSCALDDSSDSQDPTKEIRFTEAVRKLTARGFEKMPRQGCQLEQ
SSFLNPSFQWNVLNRSRRWKPPAVNQQFPQEDAGSVRRVLPGASDTLGLDNTVFCTKRIS
IHLLASHASGLNHNPACESVIDSSAFGEGKAPGPPFPQTLGIANVATRLSSIQLGQSEKE
RPEEARELDSSDRDISSATDLQPDQAETEDTEEELVDGLEDCCSRDENEEEEGDSECSSL
SAVSPSESVAMISRSCMEILTKPLSNHEKVVRPALIYSLFPNVPPTIYFGTRDERVEKLP
WEQRKLLRWKMSTVTPNIVKQTIGRSHFKISKRNDDWLGCWGHHMKSPSFRSIREHQKLN
HFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDAKLLRKAWESSSRQKWIV
KPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIY
LFSDGLVRFASCKYSPSMKSLGNKFMHLTNYSVNKKNAEYQANADEMACQGHKWALKALW
NYLSQKGVNSDAIWEKIKDVVVKTIISSEPYVTSLLKMYVRRPYSCHELFGFDIMLDENL
KPWVLEVNISPSLHSSSPLDISIKGQMIRDLLNLAGFVLPNAEDIISSPSSCSSSTTSLP
TSPGDKCRMAPEHVTAQKMKKAYYLTQKIPDQDFYASVLDVLTPDDVRILVEMEDEFSRR
GQFERIFPSHISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRSWCYKGFHMGVV
SDSAPVWSLPTSLLTISKDDVILNAFSKSETSKLGKQSSCEVSLLLSEDGTTPKSKKTQA
GLSPYPQKPSSSKDSEDTSKEPSLSTQTLPVIKCSGQTSRLSASSTFQSISDSLLAVSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14679	0.999	0.999	0.000	1199	1.000	1.000	Q14679.pdb.gz	TTLL4_HUMAN Tubulin monoglutamylase TTLL4 OS=Homo sapiens OX=9606 GN=TTLL4 PE=1 SV=2
2	AFDB:Q80UG8	0.501	0.504	0.000	1193	0.802	0.806	Q80UG8.pdb.gz	TTLL4_MOUSE Tubulin monoglutamylase TTLL4 OS=Mus musculus OX=10090 GN=Ttll4 PE=1 SV=3
3	AFDB:Q8IPB2	0.404	0.451	4.077E-62	1071	0.245	0.275	Q8IPB2.pdb.gz	Q8IPB2_DROME Tubulin tyrosine ligase-like 4A, isoform D OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=2
4	PDB:8asnG	0.236	0.751	1.857E-16	346	0.071	0.246	8asnG.pdb.gz	Crystal structure of the apo human TTL in complex with tubulin-stathmin
5	PDB:8asnF	0.215	0.764	2.588E-14	317	0.062	0.233	8asnF.pdb.gz	Crystal structure of the apo human TTL in complex with tubulin-stathmin
6	PDB:3lwbB	0.170	0.571	4.176E-6	298	0.036	0.144	3lwbB.pdb.gz
7	PDB:3lwbA	0.147	0.467	1.030E-5	323	0.033	0.121	3lwbA.pdb.gz
8	PDB:3vpbB	0.126	0.418	1.145E-5	282	0.032	0.135	3vpbB.pdb.gz	Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus
9	PDB:4c5aA	0.159	0.507	3.139E-5	306	0.034	0.134	4c5aA.pdb.gz	Inhibition of D-Ala:D-Ala ligase through a phosphorylated form of the antibiotic D-cycloserine.
10	PDB:1e4eA	0.137	0.384	3.681E-5	341	0.032	0.111	1e4eA.pdb.gz	The molecular basis of vancomycin resistance in clinically relevant Enterococci: crystal structure of D-alanyl-D-lactate ligase (VanA).
11	PDB:4fu0A	0.151	0.433	3.681E-5	343	0.035	0.122	4fu0A.pdb.gz	Structural and functional characterization of VanG D-Ala:D-Ser ligase associated with vancomycin resistance in Enterococcus faecalis
12	PDB:3u9sA	0.124	0.206	1.064E-4	621	0.029	0.056	3u9sA.pdb.gz	An unanticipated architecture of the 750-kDa {alpha}6{beta}6 holoenzyme of 3-methylcrotonyl-CoA carboxylase
13	PDB:7tn8A	0.160	0.548	1.064E-4	281	0.033	0.139	7tn8A.pdb.gz	Structural and catalytic analyses of the InsP 6 kinase activities of higher plant ITPKs.
14	AFDB:O17087	0.059	0.061	7.147E-2	1113	0.152	0.164	O17087.pdb.gz	GLD2_CAEEL Poly(A) RNA polymerase gld-2 OS=Caenorhabditis elegans OX=6239 GN=gld-2 PE=1 SV=2
15	AFDB:Q9VB52	0.050	0.045	3.332E-1	1477	0.151	0.123	Q9VB52.pdb.gz	Q9VB52_DROME LD05287p OS=Drosophila melanogaster OX=7227 GN=l(3)mbt PE=1 SV=1
16	AFDB:O43432	0.067	0.057	5.373E-1	1585	0.137	0.103	O43432.pdb.gz	IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens OX=9606 GN=EIF4G3 PE=1 SV=2
17	AFDB:Q9HFF4	0.062	0.069	5.373E-1	1023	0.123	0.145	Q9HFF4.pdb.gz	PPK1_SCHPO Serine/threonine-protein kinase ppk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppk1 PE=1 SV=2
18	AFDB:Q9BX66	0.039	0.037	7.792E-1	1292	0.123	0.115	Q9BX66.pdb.gz	SRBS1_HUMAN Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3
19	AFDB:Q9H3S7	0.055	0.047	9.137E-1	1636	0.122	0.089	Q9H3S7.pdb.gz	PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1
20	AFDB:Q586D9	0.061	0.046	9.635E-1	2060	0.135	0.079	Q586D9.pdb.gz	Q586D9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.170 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14679	0.0	2471	1199	1.000	1.000	TTLL4_HUMAN Tubulin monoglutamylase TTLL4 OS=Homo sapiens OX=9606 GN=TTLL4 PE=1 SV=2
2	Q80UG8	0.0	1877	1193	0.800	0.804	TTLL4_MOUSE Tubulin monoglutamylase TTLL4 OS=Mus musculus OX=10090 GN=Ttll4 PE=1 SV=3
3	Q8IGW4	6.79e-158	494	828	0.183	0.266	Q8IGW4_DROME RE12363p OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=2 SV=1
4	Q9VKL9	9.72e-158	493	828	0.183	0.266	Q9VKL9_DROME Tubulin tyrosine ligase-like 4A, isoform E OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=2
5	M9NCT3	1.38e-157	493	827	0.183	0.266	M9NCT3_DROME Tubulin tyrosine ligase-like 4A, isoform K OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=1
6	Q8IPB2	1.74e-155	495	1071	0.183	0.205	Q8IPB2_DROME Tubulin tyrosine ligase-like 4A, isoform D OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=2
7	M9NEE5	3.72e-155	494	1070	0.183	0.206	M9NEE5_DROME Tubulin tyrosine ligase-like 4A, isoform I OS=Drosophila melanogaster OX=7227 GN=TTLL4A PE=4 SV=1
8	Q09647	3.22e-123	395	601	0.187	0.373	TTLL4_CAEEL Tubulin polyglutamylase ttll-4 OS=Caenorhabditis elegans OX=6239 GN=ttll-4 PE=1 SV=3
9	Q8CHB8	8.18e-89	316	1328	0.143	0.129	TTLL5_MOUSE Tubulin polyglutamylase TTLL5 OS=Mus musculus OX=10090 GN=Ttll5 PE=1 SV=3
10	Q6EMB2	3.07e-88	314	1281	0.143	0.133	TTLL5_HUMAN Tubulin polyglutamylase TTLL5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=3
11	G3V2J9	1.65e-86	309	1281	0.143	0.134	G3V2J9_HUMAN Tubulin tyrosine ligase like 5 OS=Homo sapiens OX=9606 GN=TTLL5 PE=1 SV=1
12	Q9VBX5	1.39e-72	263	917	0.126	0.165	Q9VBX5_DROME LD39904p OS=Drosophila melanogaster OX=7227 GN=TTLL5 PE=2 SV=1
13	E9P886	1.23e-66	242	730	0.128	0.211	TTLL5_CAEEL Tubulin polyglutamylase ttll-5 OS=Caenorhabditis elegans OX=6239 GN=ttll-5 PE=2 SV=1
14	Q23MT7	8.05e-63	236	1195	0.118	0.119	TTL6A_TETTS Probable beta-tubulin polyglutamylase OS=Tetrahymena thermophila (strain SB210) OX=312017 GN=Ttll6a PE=3 SV=2
15	Q8N841	4.65e-61	228	843	0.105	0.149	TTLL6_HUMAN Tubulin polyglutamylase TTLL6 OS=Homo sapiens OX=9606 GN=TTLL6 PE=1 SV=2
16	A4Q9E8	2.60e-60	225	822	0.101	0.147	TTLL6_MOUSE Tubulin polyglutamylase TTLL6 OS=Mus musculus OX=10090 GN=Ttll6 PE=1 SV=1
17	F7E540	1.15e-56	215	909	0.104	0.138	TTLL7_XENTR Tubulin polyglutamylase TTLL7 OS=Xenopus tropicalis OX=8364 GN=ttll7 PE=1 SV=2
18	I6L9D0	1.91e-54	201	543	0.096	0.212	I6L9D0_HUMAN TTLL7 protein OS=Homo sapiens OX=9606 GN=TTLL7 PE=1 SV=1
19	A8CVX7	3.93e-54	206	778	0.093	0.143	TTLL6_DANRE Tubulin polyglutamylase ttll6 OS=Danio rerio OX=7955 GN=ttll6 PE=2 SV=1
20	Q6ZT98	1.24e-53	205	887	0.097	0.131	TTLL7_HUMAN Tubulin polyglutamylase TTLL7 OS=Homo sapiens OX=9606 GN=TTLL7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14397 ATPgrasp_ST	6.2	17.5	Sugar-transfer associated ATP-grasp
2	PF14398 ATPgrasp_YheCD	0.14	23.0	YheC/D like ATP-grasp
3	PF03133 TTL	3.7e-100	346.4	Tubulin-tyrosine ligase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375951

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360905	0.839	Cytosolic carboxypeptidase 6
2	9606.ENSP00000216129	0.816	Tubulin--tyrosine ligase-like protein 12
3	9606.ENSP00000349259	0.649	Spectrin beta chain, non-erythrocytic 1
4	9606.ENSP00000353249	0.640	Cytosolic carboxypeptidase-like protein 5
5	9606.ENSP00000330601	0.616	HHIP-like protein 1
6	9606.ENSP00000379946	0.615	BRD4-interacting chromatin-remodeling complex-associated protein
7	9606.ENSP00000251119	0.612	Zinc finger FYVE domain-containing protein 26
8	9606.ENSP00000363944	0.606	Ribosomal biogenesis protein LAS1L
9	9606.ENSP00000241305	0.596	Inactive carboxypeptidase-like protein X2
10	9606.ENSP00000338512	0.590	Cytosolic carboxypeptidase 1
11	9606.ENSP00000403042	0.586	Putative homeodomain transcription factor 2
12	9606.ENSP00000334501	0.572	DMRT like family C1B
13	9606.ENSP00000451752	0.562	Spectrin beta chain, erythrocytic
14	9606.ENSP00000291577	0.561	ES1 protein homolog, mitochondrial
15	9606.ENSP00000480313	0.561	Belongs to the GATD3 family
16	9606.ENSP00000471224	0.548	Doublesex- and mab-3-related transcription factor C1
17	9606.ENSP00000333836	0.525	Fidgetin
18	9606.ENSP00000356475	0.516	E3 ubiquitin-protein ligase SHPRH
19	9606.ENSP00000325905	0.512	Serine/arginine-rich splicing factor 7
20	9606.ENSP00000296930	0.507	Nucleophosmin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070740	1.000	tubulin-glutamic acid ligase activity
GO:0005488	0.833	binding
GO:0005515	0.816	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0036211	0.994	protein modification process
GO:0018200	0.980	peptidyl-glutamic acid modification
GO:0065007	0.688	biological regulation
GO:0050789	0.684	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043227	0.997	membrane-bounded organelle
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005829	0.961	cytosol
GO:0005856	0.929	cytoskeleton
GO:0015630	0.908	microtubule cytoskeleton
GO:0005815	0.825	microtubule organizing center
GO:0043231	0.780	intracellular membrane-bounded organelle
GO:0120025	0.667	plasma membrane bounded cell projection
GO:0005929	0.661	cilium
GO:0036064	0.543	ciliary basal body
GO:0005634	0.410	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.3.2.61	1.000	tubulin-glutamate ligase.

[back to server]