StarFunc result for job id Q14681

User Input

>input (263 residues)
MAELQLDPAMAGLGGGGGSGVGDGGGPVRGPPSPRPAGPTPRGHGRPAAAVAQPLEPGPG
PPERAGGGGAARWVRLNVGGTYFVTTRQTLGREPKSFLCRLCCQEDPELDSDKDETGAYL
IDRDPTYFGPILNYLRHGKLIITKELAEEGVLEEAEFYNIASLVRLVKERIRDNENRTSQ
GPVKHVYRVLQCQEEELTQMVSTMSDGWKFEQLISIGSSYNYGNEDQAEFLCVVSRELNN
STNGIVIEPSEKAKILQERGSRM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14681	1.000	1.000	3.076E-48	263	1.000	1.000	Q14681.pdb.gz	KCTD2_HUMAN BTB/POZ domain-containing protein KCTD2 OS=Homo sapiens OX=9606 GN=KCTD2 PE=1 SV=3
2	AFDB:Q8VC57	0.644	0.719	9.041E-33	234	0.639	0.718	Q8VC57.pdb.gz	KCTD5_MOUSE BTB/POZ domain-containing protein KCTD5 OS=Mus musculus OX=10090 GN=Kctd5 PE=1 SV=1
3	AFDB:Q8N5Z5	0.656	0.544	2.699E-27	321	0.551	0.452	Q8N5Z5.pdb.gz	KCD17_HUMAN BTB/POZ domain-containing protein KCTD17 OS=Homo sapiens OX=9606 GN=KCTD17 PE=1 SV=3
4	AFDB:O76889	0.456	0.403	3.693E-24	308	0.452	0.386	O76889.pdb.gz	O76889_DROME EG:196F3.2 protein OS=Drosophila melanogaster OX=7227 GN=inc PE=4 SV=1
5	AFDB:Q18776	0.590	0.574	4.174E-24	271	0.445	0.432	Q18776.pdb.gz	Q18776_CAEEL BTB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=inso-1 PE=1 SV=2
6	AFDB:Q8T9K2	0.350	0.522	1.053E-12	173	0.285	0.434	Q8T9K2.pdb.gz	Q8T9K2_DROME GM03763p OS=Drosophila melanogaster OX=7227 GN=inc PE=2 SV=1
7	AFDB:Q7L273	0.421	0.289	1.826E-12	389	0.202	0.136	Q7L273.pdb.gz	KCTD9_HUMAN BTB/POZ domain-containing protein KCTD9 OS=Homo sapiens OX=9606 GN=KCTD9 PE=1 SV=1
8	AFDB:Q54EU5	0.396	0.221	2.480E-12	488	0.224	0.121	Q54EU5.pdb.gz	Q54EU5_DICDI BTB/POZ domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=kctd9 PE=4 SV=1
9	AFDB:Q8K0E1	0.400	0.375	3.446E-11	283	0.224	0.208	Q8K0E1.pdb.gz	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
10	AFDB:D5SHR0	0.379	0.276	4.680E-11	367	0.213	0.153	D5SHR0.pdb.gz	TIWAZ_DROME BTB/POZ domain-containing protein Tiwaz OS=Drosophila melanogaster OX=7227 GN=twz PE=2 SV=1
11	PDB:7phhA	0.332	0.229	4.156E-6	396	0.133	0.088	7phhA.pdb.gz
12	PDB:7w6sB	0.314	0.195	4.156E-6	448	0.144	0.085	7w6sB.pdb.gz
13	PDB:7pquA	0.294	0.238	1.041E-5	328	0.114	0.091	7pquA.pdb.gz
14	PDB:7sizB	0.318	0.255	1.413E-5	334	0.103	0.081	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
15	PDB:2a79B	0.311	0.315	2.040E-5	259	0.103	0.104	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
16	PDB:3lutB	0.313	0.217	2.040E-5	390	0.110	0.074	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
17	PDB:7f3fA	0.311	0.187	2.945E-5	460	0.144	0.083	7f3fA.pdb.gz
18	PDB:6sgaFS	0.288	0.275	4.520E-5	277	0.133	0.126	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
19	PDB:7sszA	0.311	0.231	4.351E-4	362	0.099	0.072	7sszA.pdb.gz
20	PDB:6r7fQ	0.241	0.494	7.901E-2	112	0.076	0.179	6r7fQ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14681	0.0	536	263	1.000	1.000	KCTD2_HUMAN BTB/POZ domain-containing protein KCTD2 OS=Homo sapiens OX=9606 GN=KCTD2 PE=1 SV=3
2	Q8VC57	1.21e-119	343	234	0.616	0.692	KCTD5_MOUSE BTB/POZ domain-containing protein KCTD5 OS=Mus musculus OX=10090 GN=Kctd5 PE=1 SV=1
3	Q9NXV2	1.57e-119	343	234	0.612	0.688	KCTD5_HUMAN BTB/POZ domain-containing protein KCTD5 OS=Homo sapiens OX=9606 GN=KCTD5 PE=1 SV=1
4	Q8N5Z5	2.33e-94	282	321	0.506	0.414	KCD17_HUMAN BTB/POZ domain-containing protein KCTD17 OS=Homo sapiens OX=9606 GN=KCTD17 PE=1 SV=3
5	Q9W579	6.21e-76	231	211	0.452	0.564	Q9W579_DROME Insomniac, isoform B OS=Drosophila melanogaster OX=7227 GN=inc PE=2 SV=1
6	O76889	6.35e-75	232	308	0.452	0.386	O76889_DROME EG:196F3.2 protein OS=Drosophila melanogaster OX=7227 GN=inc PE=4 SV=1
7	Q18776	2.64e-71	221	271	0.418	0.406	Q18776_CAEEL BTB domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=inso-1 PE=1 SV=2
8	Q8T9K2	1.48e-40	139	173	0.247	0.376	Q8T9K2_DROME GM03763p OS=Drosophila melanogaster OX=7227 GN=inc PE=2 SV=1
9	Q7L273	1.96e-22	97.1	389	0.205	0.139	KCTD9_HUMAN BTB/POZ domain-containing protein KCTD9 OS=Homo sapiens OX=9606 GN=KCTD9 PE=1 SV=1
10	Q54EU5	1.29e-21	95.5	488	0.194	0.105	Q54EU5_DICDI BTB/POZ domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=kctd9 PE=4 SV=1
11	Q582M7	3.16e-18	86.3	639	0.186	0.077	Q582M7_TRYB2 BTB domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.33N13.160 PE=4 SV=1
12	Q6P7W2	5.10e-18	85.5	704	0.202	0.075	SHKB1_MOUSE SH3KBP1-binding protein 1 OS=Mus musculus OX=10090 GN=Shkbp1 PE=1 SV=1
13	Q8TBC3	7.17e-18	85.1	707	0.202	0.075	SHKB1_HUMAN SH3KBP1-binding protein 1 OS=Homo sapiens OX=9606 GN=SHKBP1 PE=1 SV=2
14	Q8BFX3	9.53e-16	79.0	815	0.190	0.061	KCTD3_MOUSE BTB/POZ domain-containing protein KCTD3 OS=Mus musculus OX=10090 GN=Kctd3 PE=1 SV=1
15	Q6WVG3	3.12e-11	64.7	327	0.137	0.110	KCD12_MOUSE BTB/POZ domain-containing protein KCTD12 OS=Mus musculus OX=10090 GN=Kctd12 PE=1 SV=1
16	D5SHR0	6.88e-11	63.9	367	0.156	0.112	TIWAZ_DROME BTB/POZ domain-containing protein Tiwaz OS=Drosophila melanogaster OX=7227 GN=twz PE=2 SV=1
17	Q50H33	1.10e-10	63.5	476	0.194	0.107	KCTD8_MOUSE BTB/POZ domain-containing protein KCTD8 OS=Mus musculus OX=10090 GN=Kctd8 PE=1 SV=1
18	Q96CX2	1.31e-10	62.8	325	0.137	0.111	KCD12_HUMAN BTB/POZ domain-containing protein KCTD12 OS=Homo sapiens OX=9606 GN=KCTD12 PE=1 SV=1
19	Q8K0E1	1.50e-10	62.4	283	0.202	0.187	KCD15_MOUSE BTB/POZ domain-containing protein KCTD15 OS=Mus musculus OX=10090 GN=Kctd15 PE=1 SV=1
20	Q8WVF5	1.77e-10	62.0	259	0.144	0.147	KCTD4_HUMAN BTB/POZ domain-containing protein KCTD4 OS=Homo sapiens OX=9606 GN=KCTD4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	49	15.6	BTB/POZ domain
2	PF02214 BTB_2	1.6e-19	81.3	BTB/POZ domain
3	PF16017 BTB_3	68	14.8	BTB/POZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000000993

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003972	0.885	Cullin 3
2	60711.ENSCSAP00000016464	0.736	Potassium voltage-gated channel, Shaw-related subfamily, member 4
3	60711.ENSCSAP00000017621	0.669	Potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3
4	60711.ENSCSAP00000008800	0.660	Potassium voltage-gated channel, subfamily G, member 3
5	60711.ENSCSAP00000011112	0.647	Potassium voltage-gated channel, Shab-related subfamily, member 1
6	60711.ENSCSAP00000013669	0.635	Protocadherin 17
7	60711.ENSCSAP00000017438	0.614	Potassium channel tetramerization domain containing 11
8	60711.ENSCSAP00000010121	0.607	Glutamate receptor, metabotropic 2
9	60711.ENSCSAP00000018944	0.606	Leucine rich repeat transmembrane neuronal 1
10	60711.ENSCSAP00000001110	0.587	Belongs to the cullin family.
11	60711.ENSCSAP00000003333	0.587	Cullin 1
12	60711.ENSCSAP00000017824	0.573	Potassium voltage-gated channel, shaker-related subfamily, member 2
13	60711.ENSCSAP00000000058	0.562	SH3KBP1 binding protein 1
14	60711.ENSCSAP00000019209	0.561	Zinc finger and BTB domain containing 6
15	60711.ENSCSAP00000011097	0.550	Golgi reassembly stacking protein 2, 55kDa
16	60711.ENSCSAP00000019037	0.544	Kelch-like family member 34
17	60711.ENSCSAP00000018730	0.542	Potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia)
18	60711.ENSCSAP00000009395	0.536	Solute carrier family 4, sodium borate transporter, member 11
19	60711.ENSCSAP00000008204	0.515	Solute carrier family 33 (acetyl-CoA transporter), member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.999	protein-containing complex binding
GO:0005515	0.999	protein binding
GO:0042802	0.840	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.994	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0009987	0.937	cellular process
GO:0071704	0.902	organic substance metabolic process
GO:0044238	0.894	primary metabolic process
GO:0006807	0.797	nitrogen compound metabolic process
GO:1901564	0.743	organonitrogen compound metabolic process
GO:0043170	0.709	macromolecule metabolic process
GO:0019538	0.680	protein metabolic process
GO:0044237	0.565	cellular metabolic process
GO:0043632	0.486	modification-dependent macromolecule catabolic process
GO:0019941	0.475	modification-dependent protein catabolic process
GO:0006511	0.471	ubiquitin-dependent protein catabolic process
GO:0048518	0.397	positive regulation of biological process
GO:0048522	0.323	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.990	cytosol
GO:0032991	0.957	protein-containing complex
GO:0043227	0.905	membrane-bounded organelle
GO:0043231	0.888	intracellular membrane-bounded organelle
GO:0005634	0.703	nucleus
GO:0070013	0.498	intracellular organelle lumen
GO:0031981	0.465	nuclear lumen
GO:0005654	0.459	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]