StarFunc result for job id Q14683

User Input

>input (1233 residues)
MGFLKLIEIENFKSYKGRQIIGPFQRFTAIIGPNGSGKSNLMDAISFVLGEKTSNLRVKT
LRDLIHGAPVGKPAANRAFVSMVYSEEGAEDRTFARVIVGGSSEYKINNKVVQLHEYSEE
LEKLGILIKARNFLVFQGAVESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEE
DTQFNYHRKKNIAAERKEAKQEKEEADRYQRLKDEVVRAQVQLQLFKLYHNEVEIEKLNK
ELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQIEKEIKEKDSELNQKRPQYIK
AKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEFEERMEEESQS
QGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAK
IKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQV
MEQLGDARIDRQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGK
NMDAIIVDSEKTGRDCIQYIKEQRGEPETFLPLDYLEVKPTDEKLRELKGAKLVIDVIRY
EPPHIKKALQYACGNALVCDNVEDARRIAFGGHQRHKTVALDGTLFQKSGVISGGASDLK
AKARRWDEKAVDKLKEKKERLTEELKEQMKAKRKEAELRQVQSQAHGLQMRLKYSQSDLE
QTKTRHLALNLQEKSKLESELANFGPRINDIKRIIQSREREMKDLKEKMNQVEDEVFEEF
CREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQ
TVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGG
ANKEMTHLQKEVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTMDDISQEEGSSQGE
DSVSGSQRISSIYAREALIEIDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRI
AAPNMKAMEKLESVRDKFQETSDEFEAARKRAKKAKQAFEQIKKERFDRFNACFESVATN
IDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGKRFRPMDNLSGGEKTVAALAL
LFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLKEEFYTKAESL
IGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QCL7	0.403	0.398	0.000	1251	0.878	0.866	A0A2R8QCL7.pdb.gz
2	AFDB:O01789	0.437	0.428	0.000	1262	0.426	0.416	O01789.pdb.gz	SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans OX=6239 GN=him-1 PE=1 SV=4
3	AFDB:Q8AWB7	0.393	0.392	0.000	1234	0.945	0.944	Q8AWB7.pdb.gz	Q8AWB7_CHICK Structural maintenance of chromosomes protein OS=Gallus gallus OX=9031 GN=SMC1 PE=2 SV=2
4	AFDB:Q8NDV3	0.412	0.412	0.000	1235	0.528	0.527	Q8NDV3.pdb.gz	SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens OX=9606 GN=SMC1B PE=2 SV=3
5	AFDB:Q920F6	0.370	0.367	0.000	1248	0.518	0.512	Q920F6.pdb.gz	SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus OX=10090 GN=Smc1b PE=1 SV=1
6	AFDB:Q9N6I4	0.365	0.364	0.000	1238	0.485	0.483	Q9N6I4.pdb.gz	Q9N6I4_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC1 PE=2 SV=1
7	AFDB:Q6Q1P4	0.338	0.341	2.360E-97	1218	0.357	0.361	Q6Q1P4.pdb.gz	SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana OX=3702 GN=SMC1 PE=2 SV=2
8	AFDB:O94383	0.661	0.664	1.073E-95	1228	0.337	0.339	O94383.pdb.gz	SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psm1 PE=1 SV=2
9	AFDB:P32908	0.401	0.403	3.415E-81	1225	0.302	0.304	P32908.pdb.gz	SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC1 PE=1 SV=1
10	AFDB:Q38DK9	0.496	0.484	5.802E-81	1275	0.284	0.275	Q38DK9.pdb.gz	Q38DK9_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2970 PE=3 SV=1
11	PDB:6wg3A	0.315	0.687	1.189E-69	561	0.450	0.989	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
12	PDB:6yvuB	0.309	0.318	4.494E-51	1191	0.225	0.233	6yvuB.pdb.gz
13	PDB:6wgeA	0.312	0.975	2.186E-36	390	0.313	0.990	6wgeA.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
14	PDB:6yvuA	0.225	0.244	5.546E-35	1127	0.188	0.206	6yvuA.pdb.gz
15	PDB:7qcdA	0.296	0.349	6.327E-27	1028	0.133	0.160	7qcdA.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
16	PDB:7qcdB	0.260	0.303	9.668E-27	998	0.149	0.184	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
17	PDB:6wg3B	0.247	0.424	2.727E-25	693	0.145	0.258	6wg3B.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
18	PDB:7ogtA	0.248	0.394	3.414E-21	688	0.104	0.186	7ogtA.pdb.gz
19	PDB:7ogtB	0.165	0.243	4.479E-19	708	0.092	0.161	7ogtB.pdb.gz
20	PDB:6yufA	0.151	0.472	1.301E-16	384	0.078	0.250	6yufA.pdb.gz	A Structure-Based Mechanism for DNA Entry into the Cohesin Ring.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MR33	0.0	2503	1233	1.000	1.000	A0A384MR33_HUMAN Structural maintenance of chromosomes protein OS=Homo sapiens OX=9606 GN=SMC1L1 PE=2 SV=1
2	E7F0X6	0.0	2123	1232	0.891	0.892	E7F0X6_DANRE Structural maintenance of chromosomes protein OS=Danio rerio OX=7955 GN=smc1a PE=3 SV=1
3	G8JLG1	0.0	2422	1211	0.971	0.988	G8JLG1_HUMAN Structural maintenance of chromosomes protein OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2
4	O01789	0.0	941	1262	0.427	0.418	SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans OX=6239 GN=him-1 PE=1 SV=4
5	O94383	0.0	667	1228	0.353	0.354	SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psm1 PE=1 SV=2
6	Q14683	0.0	2503	1233	1.000	1.000	SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2
7	Q6DRM9	0.0	2154	1233	0.898	0.898	Q6DRM9_DANRE Structural maintenance of chromosomes protein OS=Danio rerio OX=7955 GN=im:7158706 PE=1 SV=1
8	Q6Q1P4	0.0	720	1218	0.371	0.376	SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana OX=3702 GN=SMC1 PE=2 SV=2
9	Q8AWB7	0.0	2295	1234	0.946	0.945	Q8AWB7_CHICK Structural maintenance of chromosomes protein OS=Gallus gallus OX=9031 GN=SMC1 PE=2 SV=2
10	Q8NDV3	0.0	1338	1235	0.529	0.528	SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens OX=9606 GN=SMC1B PE=2 SV=3
11	Q920F6	0.0	1286	1248	0.518	0.512	SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus OX=10090 GN=Smc1b PE=1 SV=1
12	Q9CU62	0.0	2498	1233	0.998	0.998	SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus OX=10090 GN=Smc1a PE=1 SV=4
13	Q9N6I4	0.0	1148	1238	0.491	0.489	Q9N6I4_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC1 PE=2 SV=1
14	Q9VCD8	0.0	1149	1238	0.491	0.489	Q9VCD8_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=SMC1 PE=1 SV=1
15	Q9Z1M9	0.0	2491	1233	0.996	0.996	SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus OX=10116 GN=Smc1a PE=1 SV=1
16	V9GY57	2.19e-169	504	279	0.195	0.864	V9GY57_HUMAN Structural maintenance of chromosomes 1A (Fragment) OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=1
17	P32908	1.87e-157	505	1225	0.324	0.326	SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC1 PE=1 SV=1
18	Q38DK9	3.92e-143	468	1275	0.315	0.305	Q38DK9_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2970 PE=3 SV=1
19	Q8CG47	1.37e-74	273	1286	0.268	0.257	SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus OX=10090 GN=Smc4 PE=1 SV=1
20	P50532	5.83e-74	272	1290	0.263	0.251	SMC4_XENLA Structural maintenance of chromosomes protein 4 OS=Xenopus laevis OX=8355 GN=smc4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	1.1e-09	50.0	AAA ATPase domain
2	PF13304 AAA_21	9.3e-10	50.4	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13476 AAA_23	1.7e-09	50.1	AAA domain
4	PF13555 AAA_29	0.00059	30.9	P-loop containing region of AAA domain
5	PF00005 ABC_tran	57	15.7	ABC transporter
6	PF11887 Mce4_CUP1	2.1e+02	12.8	Cholesterol uptake porter CUP1 of Mce4, putative
7	PF13558 SbcC_Walker_B	1.8e+02	13.8	SbcC/RAD50-like, Walker B motif
8	PF06470 SMC_hinge	9e-23	92.2	SMC proteins Flexible Hinge Domain
9	PF02463 SMC_N	3.4e-46	169.0	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010362826.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010352900.1	0.999	Stromal antigen 2
2	61622.XP_010363127.1	0.999	Stromal antigen 1
3	61622.XP_010368625.1	0.999	Structural maintenance of chromosomes 3
4	61622.XP_010385178.1	0.999	RAD21 cohesin complex component
5	61622.XP_010375999.1	0.997	Stromal antigen 3
6	61622.XP_010359605.1	0.995	Double-strand-break repair protein rad21-like protein 1
7	61622.XP_010362076.1	0.995	REC8 meiotic recombination protein
8	61622.XP_010365844.1	0.989	Structural maintenance of chromosomes protein 1B isoform X1
9	61622.XP_010371685.1	0.988	NIPBL, cohesin loading factor
10	61622.XP_010382861.1	0.985	PDS5 cohesin associated factor A
11	61622.XP_010365355.1	0.983	PDS5 cohesin associated factor B
12	61622.XP_010357822.1	0.982	Structural maintenance of chromosomes protein 2-like
13	61622.XP_010365012.1	0.976	Structural maintenance of chromosomes protein 4 isoform X1
14	61622.XP_010351489.1	0.975	NDC80, kinetochore complex component
15	61622.XP_010372232.1	0.975	Extra spindle pole bodies like 1, separase
16	61622.XP_010362413.1	0.973	Structural maintenance of chromosomes protein 2
17	61622.XP_010353141.1	0.951	Structural maintenance of chromosomes 6
18	61622.XP_010382725.1	0.948	Replication factor C subunit 1 isoform X1
19	61622.XP_010361246.1	0.947	Structural maintenance of chromosomes protein 5 isoform X1
20	61622.XP_010352101.1	0.941	Wings apart-like protein homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0003676	0.998	nucleic acid binding
GO:0046983	0.916	protein dimerization activity
GO:0003677	0.841	DNA binding
GO:0046982	0.800	protein heterodimerization activity
GO:0044877	0.626	protein-containing complex binding
GO:0140657	0.616	ATP-dependent activity
GO:0003824	0.609	catalytic activity
GO:0042802	0.325	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0007049	0.970	cell cycle
GO:0051321	0.669	meiotic cell cycle
GO:0050789	0.637	regulation of biological process
GO:0071840	0.627	cellular component organization or biogenesis
GO:0071704	0.607	organic substance metabolic process
GO:0016043	0.607	cellular component organization
GO:0050794	0.606	regulation of cellular process
GO:0044238	0.578	primary metabolic process
GO:0006807	0.550	nitrogen compound metabolic process
GO:0044237	0.514	cellular metabolic process
GO:0043170	0.512	macromolecule metabolic process
GO:0006996	0.491	organelle organization
GO:0022402	0.416	cell cycle process
GO:0050896	0.403	response to stimulus
GO:1901360	0.333	organic cyclic compound metabolic process
GO:0006725	0.331	cellular aromatic compound metabolic process
GO:0046483	0.325	heterocycle metabolic process
GO:0090304	0.324	nucleic acid metabolic process
GO:0051716	0.312	cellular response to stimulus
GO:0044260	0.312	cellular macromolecule metabolic process
GO:0006950	0.300	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.986	cytosol
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0032991	0.974	protein-containing complex
GO:0005694	0.881	chromosome
GO:0044815	0.705	DNA packaging complex
GO:0008278	0.346	cohesin complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]