StarFunc result for job id Q14684

User Input

>input (758 residues)
MAPAMQPAEIQFAQRLASSEKGIRDRAVKKLRQYISVKTQRETGGFSQEELLKIWKGLFY
CMWVQDEPLLQEELANTIAQLVHAVNNSAAQHLFIQTFWQTMNREWKGIDRLRLDKYYML
IRLVLRQSFEVLKRNGWEESRIKVFLDVLMKEVLCPESQSPNGVRFHFIDIYLDELSKVG
GKELLADQNLKFIDPFCKIAAKTKDHTLVQTIARGVFEAIVDQSPFVPEETMEEQKTKVG
DGDLSAEEIPENEVSLRRAVSKKKTALGKNHSRKDGLSDERGRDDCGTFEDTGPLLQFDY
KAVADRLLEMTSRKNTPHFNRKRLSKLIKKFQDLSEGSSISQLSFAEDISADEDDQILSQ
GKHKKKGNKLLEKTNLEKEKGSRVFCVEEEDSESSLQKRRRKKKKKHHLQPENPGPGGAA
PSLEQNRGREPEASGLKALKARVAEPGAEATSSTGEESGSEHPPAVPMHNKRKRPRKKSP
RAHREMLESAVLPPEDMSQSGPSGSHPQGPRGSPTGGAQLLKRKRKLGVVPVNGSGLSTP
AWPPLQQEGPPTGPAEGANSHTTLPQRRRLQKKKAGPGSLELCGLPSQKTASLKKRKKMR
VMSNLVEHNGVLESEAGQPQALGSSGTCSSLKKQKLRAESDFVKFDTPFLPKPLFFRRAK
SSTATHPPGPAVQLNKTPSSSKKVTFGLNRNMTAEFKKTDKSILVSPTGPSRVAFDPEQK
PLHGVLKTPTSSPASSPLVAKKPLTTTPRRRPRAMDFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14684	1.000	1.000	2.832E-77	758	1.000	1.000	Q14684.pdb.gz	RRP1B_HUMAN Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3
2	AFDB:Q91YK2	0.413	0.431	5.166E-48	724	0.617	0.646	Q91YK2.pdb.gz	RRP1B_MOUSE Ribosomal RNA processing protein 1 homolog B OS=Mus musculus OX=10090 GN=Rrp1b PE=1 SV=2
3	AFDB:P56182	0.366	0.597	8.194E-29	461	0.256	0.421	P56182.pdb.gz	RRP1_HUMAN Ribosomal RNA processing protein 1 homolog A OS=Homo sapiens OX=9606 GN=RRP1 PE=1 SV=1
4	PDB:6c0fz	0.216	0.649	1.159E-8	243	0.086	0.267	6c0fz.pdb.gz	Modular assembly of the nucleolar pre-60S ribosomal subunit.
5	PDB:5z3gX	0.198	0.710	4.146E-7	202	0.082	0.307	5z3gX.pdb.gz	Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.
6	AFDB:Q96QP1	0.102	0.075	8.738E-3	1244	0.142	0.087	Q96QP1.pdb.gz	ALPK1_HUMAN Alpha-protein kinase 1 OS=Homo sapiens OX=9606 GN=ALPK1 PE=1 SV=3
7	AFDB:Q8T498	0.090	0.056	2.472E-2	1580	0.160	0.077	Q8T498.pdb.gz	GAP2_DROME Ras GTPase-activating protein raskol OS=Drosophila melanogaster OX=7227 GN=raskol PE=1 SV=3
8	AFDB:Q9CXB8	0.105	0.076	3.746E-2	1231	0.140	0.086	Q9CXB8.pdb.gz	ALPK1_MOUSE Alpha-protein kinase 1 OS=Mus musculus OX=10090 GN=Alpk1 PE=2 SV=2
9	AFDB:Q4G0F8	0.091	0.067	4.071E-2	1135	0.182	0.122	Q4G0F8.pdb.gz	UBN1_MOUSE Ubinuclein-1 OS=Mus musculus OX=10090 GN=Ubn1 PE=2 SV=1
10	AFDB:Q5SML5	0.069	0.074	6.706E-2	696	0.141	0.154	Q5SML5.pdb.gz	ORR22_ORYSJ Two-component response regulator ORR22 OS=Oryza sativa subsp. japonica OX=39947 GN=RR22 PE=2 SV=1
11	AFDB:P26675	0.079	0.042	9.751E-2	1596	0.144	0.068	P26675.pdb.gz	SOS_DROME Protein son of sevenless OS=Drosophila melanogaster OX=7227 GN=Sos PE=1 SV=2
12	AFDB:Q9NPG3	0.100	0.077	1.016E-1	1134	0.174	0.116	Q9NPG3.pdb.gz	UBN1_HUMAN Ubinuclein-1 OS=Homo sapiens OX=9606 GN=UBN1 PE=1 SV=2
13	PDB:4a0cA	0.174	0.123	1.182E-1	1155	0.046	0.030	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
14	PDB:6gx9A	0.135	0.119	1.284E-1	912	0.047	0.039	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
15	PDB:5svdA	0.078	0.098	1.455E-1	543	0.049	0.068	5svdA.pdb.gz
16	PDB:5tbkA	0.135	0.204	1.455E-1	417	0.033	0.060	5tbkA.pdb.gz
17	PDB:4c0qA	0.128	0.116	1.946E-1	871	0.049	0.042	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
18	PDB:1qgkA	0.104	0.093	2.029E-1	876	0.049	0.042	1qgkA.pdb.gz
19	PDB:6n1zA	0.117	0.099	2.115E-1	961	0.051	0.041	6n1zA.pdb.gz
20	PDB:7k36A	0.144	0.180	2.115E-1	554	0.049	0.067	7k36A.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14684	0.0	1551	758	1.000	1.000	RRP1B_HUMAN Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B PE=1 SV=3
2	Q91YK2	0.0	818	724	0.613	0.642	RRP1B_MOUSE Ribosomal RNA processing protein 1 homolog B OS=Mus musculus OX=10090 GN=Rrp1b PE=1 SV=2
3	P56182	1.69e-118	366	461	0.277	0.456	RRP1_HUMAN Ribosomal RNA processing protein 1 homolog A OS=Homo sapiens OX=9606 GN=RRP1 PE=1 SV=1
4	Q9Y7M6	2.18e-29	118	217	0.094	0.327	RRP1_SCHPO Ribosomal RNA-processing protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC9B6.07 PE=1 SV=1
5	P35178	7.08e-23	101	278	0.090	0.245	RRP1_YEAST Ribosomal RNA-processing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP1 PE=1 SV=2
6	Q57X33	6.52e-14	77.8	623	0.041	0.050	Q57X33_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.26E13.60 PE=3 SV=1
7	A0A5F8MPU3	0.10	38.9	2282	0.037	0.012	CTSRT_MOUSE Cation channel sperm-associated targeting subunit tau OS=Mus musculus OX=10090 GN=C2cd6 PE=1 SV=1
8	Q09725	1.1	35.4	1587	0.030	0.014	MIS4_SCHPO Sister chromatid cohesion protein mis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mis4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05997 Nop52	5.7e-69	243.8	Nucleolar protein,Nop52

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339145

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000455106	0.992	Ribosome biogenesis protein BOP1
2	9606.ENSP00000346725	0.988	Pescadillo homolog
3	9606.ENSP00000261015	0.987	Ribosome biogenesis protein WDR12
4	9606.ENSP00000353246	0.985	Protein MAK16 homolog
5	9606.ENSP00000396673	0.984	pre-rRNA processing protein FTSJ3
6	9606.ENSP00000359688	0.982	Ribosome production factor 1
7	9606.ENSP00000407323	0.978	Probable rRNA-processing protein EBP2
8	9606.ENSP00000371858	0.976	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
9	9606.ENSP00000285814	0.973	Nucleolar protein interacting with the FHA domain of MKI67
10	9606.ENSP00000432119	0.973	WD repeat-containing protein 74
11	9606.ENSP00000317992	0.966	Nucleolar complex protein 2 homolog
12	9606.ENSP00000460871	0.966	Ribosomal L1 domain-containing protein 1
13	9606.ENSP00000254940	0.965	60S ribosome subunit biogenesis protein NIP7 homolog
14	9606.ENSP00000364320	0.964	mRNA turnover protein 4 homolog
15	9606.ENSP00000338862	0.959	Ribosome biogenesis protein BRX1 homolog
16	9606.ENSP00000355899	0.958	RRP15-like protein
17	9606.ENSP00000354040	0.951	Nucleolar GTP-binding protein 1
18	9606.ENSP00000483484	0.950	Ribosome biogenesis protein NSA2 homolog
19	9606.ENSP00000264279	0.948	Nucleolar protein 58
20	9606.ENSP00000254605	0.946	Ribosomal RNA-processing protein 8

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0050794	0.980	regulation of cellular process
GO:0031325	0.945	positive regulation of cellular metabolic process
GO:0050896	0.912	response to stimulus
GO:0010468	0.901	regulation of gene expression
GO:0051254	0.900	positive regulation of RNA metabolic process
GO:0031326	0.885	regulation of cellular biosynthetic process
GO:0010557	0.881	positive regulation of macromolecule biosynthetic process
GO:0031328	0.881	positive regulation of cellular biosynthetic process
GO:1902680	0.818	positive regulation of RNA biosynthetic process
GO:0045893	0.797	positive regulation of DNA-templated transcription
GO:0009615	0.779	response to virus
GO:0098586	0.722	cellular response to virus
GO:0044403	0.714	biological process involved in symbiotic interaction
GO:0010941	0.701	regulation of cell death
GO:0051702	0.683	biological process involved in interaction with symbiont
GO:0009987	0.671	cellular process
GO:0051851	0.654	modulation by host of symbiont process
GO:0010942	0.614	positive regulation of cell death
GO:0006357	0.581	regulation of transcription by RNA polymerase II
GO:0071704	0.554	organic substance metabolic process
GO:0044237	0.513	cellular metabolic process
GO:0044238	0.512	primary metabolic process
GO:0006807	0.502	nitrogen compound metabolic process
GO:0034641	0.492	cellular nitrogen compound metabolic process
GO:1901360	0.465	organic cyclic compound metabolic process
GO:0010467	0.455	gene expression
GO:0043067	0.449	regulation of programmed cell death
GO:0006139	0.449	nucleobase-containing compound metabolic process
GO:0071840	0.425	cellular component organization or biogenesis
GO:0016070	0.421	RNA metabolic process
GO:0043068	0.340	positive regulation of programmed cell death
GO:0042981	0.312	regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005694	1.000	chromosome
GO:0005730	1.000	nucleolus
GO:0005654	0.999	nucleoplasm
GO:0005829	0.998	cytosol
GO:0001652	0.506	granular component
GO:0032991	0.417	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]