StarFunc result for job id Q14686

User Input

>input (2063 residues)
MVLDDLPNLEDIYTSLCSSTMEDSEMDFDSGLEDDDTKSDSILEDSTIFVAFKGNIDDKD
FKWKLDAILKNVPNLLHMESSKLKVQKVEPWNSVRVTFNIPREAAERLRILAQSNNQQLR
DLGILSVQIEGEGAINLALAQNRSQDVRMNGPMGAGNSVRMEAGFPMASGPGIIRMNNPA
TVMIPPGGNVSSSMMAPGPNPELQPRTPRPASQSDAMDPLLSGLHIQQQSHPSGSLAPPH
HPMQPVSVNRQMNPANFPQLQQQQQQQQQQQQQQQQQQQQQQQQQLQARPPQQHQQQQPQ
GIRPQFTAPTQVPVPPGWNQLPSGALQPPPAQGSLGTMTANQGWKKAPLPGPMQQQLQAR
PSLATVQTPSHPPPPYPFGSQQASQAHTNFPQMSNPGQFTAPQMKSLQGGPSRVPTPLQQ
PHLTNKSPASSPSSFQQGSPASSPTVNQTQQQMGPRPPQNNPLPQGFQQPVSSPGRNPMV
QQGNVPPNFMVMQQQPPNQGPQSLHPGLGGMPKRLPPGFSAGQANPNFMQGQVPSTTATT
PGNSGAPQLQANQNVQHAGGQGAGPPQNQMQVSHGPPNMMQPSLMGIHGNMNNQQAGTSG
VPQVNLSNMQGQPQQGPPSQLMGMHQQIVPSQGQMVQQQGTLNPQNPMILSRAQLMPQGQ
MMVNPPSQNLGPSPQRMTPPKQMLSQQGPQMMAPHNQMMGPQGQVLLQQNPMIEQIMTNQ
MQGNKQQFNTQNQSNVMPGPAQIMRGPTPNMQGNMVQFTGQMSGQMLPQQGPVNNSPSQV
MGIQGQVLRPPGPSPHMAQQHGDPATTANNDVSLSQMMPDVSIQQTNMVPPHVQAMQGNS
ASGNHFSGHGMSFNAPFSGAPNGNQMSCGQNPGFPVNKDVTLTSPLLVNLLQSDISAGHF
GVNNKQNNTNANKPKKKKPPRKKKNSQQDLNTPDTRPAGLEEADQPPLPGEQGINLDNSG
PKLPEFSNRPPGYPSQPVEQRPLQQMPPQLMQHVAPPPQPPQQQPQPQLPQQQQPPPPSQ
PQSQQQQQQQQQMMMMLMMQQDPKSVRLPVSQNVHPPRGPLNPDSQRMPMQQSGSVPVMV
SLQGPASVPPSPDKQRMPMPVNTPLGSNSRKMVYQESPQNPSSSPLAEMASLPEASGSEA
PSVPGGPNNMPSHVVLPQNQLMMTGPKPGPSPLSATQGATPQQPPVNSLPSSHGHHFPNV
AAPTQTSRPKTPNRASPRPYYPQTPNNRPPSTEPSEISLSPERLNASIAGLFPPQINIPL
PPRPNLNRGFDQQGLNPTTLKAIGQAPSNLTMNPSNFATPQTHKLDSVVVNSGKQSNSGA
TKRASPSNSRRSSPGSSRKTTPSPGRQNSKAPKLTLASQTNAALLQNVELPRNVLVSPTP
LANPPVPGSFPNNSGLNPQNSTVSVAAVGGVVEDNKESLNVPQDSDCQNSQSRKEQVNIE
LKAVPAQEVKMVVPEDQSKKDGQPSDPNKLPSVEENKNLVSPAMREAPTSLSQLLDNSGA
PNVTIKPPGLTDLEVTPPVVSGEDLKKASVIPTLQDLSSSKEPSNSLNLPHSNELCSSLV
HPELSEVSSNVAPSIPPVMSRPVSSSSISTPLPPNQITVFVTSNPITTSANTSAALPTHL
QSALMSTVVTMPNAGSKVMVSEGQSAAQSNARPQFITPVFINSSSIIQVMKGSQPSTIPA
APLTTNSGLMPPSVAVVGPLHIPQNIKFSSAPVPPNALSSSPAPNIQTGRPLVLSSRATP
VQLPSPPCTSSPVVPSHPPVQQVKELNPDEASPQVNTSADQNTLPSSQSTTMVSPLLTNS
PGSSGNRRSPVSSSKGKGKVDKIGQILLTKACKKVTGSLEKGEEQYGADGETEGQGLDTT
APGLMGTEQLSTELDSKTPTPPAPTLLKMTSSPVGPGTASAGPSLPGGALPTSVRSIVTT
LVPSELISAVPTTKSNHGGIASESLAGGLVEEKVGSHPELLPSIAPSQNLVSKETSTTAL
QASVARPELEVNAAIVSGQSSEPKEIVEKSKIPGRRNSRTEEPTVASESVENGHRKRSSR
PASASSSTKDITSAVQSKRRKSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F6M2K2	0.069	0.120	0.000	1070	0.479	0.923	F6M2K2.pdb.gz	F6M2K2_HUMAN Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=1
2	AFDB:Q9JL19	0.189	0.189	0.000	2067	0.914	0.912	Q9JL19.pdb.gz	NCOA6_MOUSE Nuclear receptor coactivator 6 OS=Mus musculus OX=10090 GN=Ncoa6 PE=1 SV=1
3	AFDB:Q8IJP9	0.030	0.026	3.008E-3	2578	0.132	0.106	Q8IJP9.pdb.gz	Q8IJP9_PLAF7 Transcriptional coactivator ADA2 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1014600 PE=4 SV=1
4	AFDB:Q9NZW4	0.021	0.030	3.505E-2	1301	0.093	0.147	Q9NZW4.pdb.gz	DSPP_HUMAN Dentin sialophosphoprotein OS=Homo sapiens OX=9606 GN=DSPP PE=1 SV=2
5	AFDB:Q9W2S5	0.029	0.030	3.752E-2	2139	0.140	0.135	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
6	AFDB:O96433	0.022	0.035	1.801E-1	1097	0.085	0.160	O96433.pdb.gz	CCNT_DROME Cyclin-T OS=Drosophila melanogaster OX=7227 GN=CycT PE=1 SV=2
7	AFDB:Q9ULI3	0.025	0.031	2.065E-1	1381	0.090	0.134	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
8	AFDB:Q7Z6E9	0.033	0.036	2.712E-1	1792	0.110	0.126	Q7Z6E9.pdb.gz	RBBP6_HUMAN E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1
9	AFDB:Q9EPQ8	0.029	0.029	3.109E-1	1987	0.163	0.169	Q9EPQ8.pdb.gz	TCF20_MOUSE Transcription factor 20 OS=Mus musculus OX=10090 GN=Tcf20 PE=1 SV=3
10	AFDB:Q15648	0.020	0.025	3.815E-1	1581	0.095	0.125	Q15648.pdb.gz	MED1_HUMAN Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4
11	PDB:6exnO	0.016	0.073	6.880	320	0.010	0.066	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
12	PDB:2kg7A	0.015	0.179	9.037	97	0.005	0.113	2kg7A.pdb.gz
13	PDB:5ko7B	0.015	0.099	9.037	200	0.005	0.055	5ko7B.pdb.gz	Active Site Binding Is Not Sufficient for Reductive Deiodination by Iodotyrosine Deiodinase.
14	PDB:1gyxA	0.017	0.278	9.675	76	0.006	0.158	1gyxA.pdb.gz	The Crystal Structure of Ydce, a 4-Oxalocrotonate Tautomerase Homologue from Escherichia Coli, Confirms the Structural Basis for Oligomer Diversity
15	PDB:2aczC	0.014	0.115	9.675	129	0.004	0.070	2aczC.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
16	PDB:6ylxw	0.010	0.052	9.675	360	0.006	0.036	6ylxw.pdb.gz	Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F6M2K2	0.0	1924	1070	0.472	0.910	F6M2K2_HUMAN Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=1
2	F6M2K4	0.0	1909	982	0.471	0.989	F6M2K4_HUMAN Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=1
3	Q14686	0.0	4026	2063	1.000	1.000	NCOA6_HUMAN Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=3
4	Q9JL19	0.0	1674	2067	0.449	0.448	NCOA6_MOUSE Nuclear receptor coactivator 6 OS=Mus musculus OX=10090 GN=Ncoa6 PE=1 SV=1
5	Q9JLI4	1.15e-150	474	418	0.126	0.622	NCOA6_RAT Nuclear receptor coactivator 6 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ncoa6 PE=1 SV=2
6	M9NES4	3.24e-05	52.0	2266	0.014	0.012	M9NES4_DROME Nuclear receptor coactivator 6, isoform D OS=Drosophila melanogaster OX=7227 GN=Ncoa6 PE=4 SV=1
7	A8DYV5	3.67e-05	51.6	2467	0.014	0.011	A8DYV5_DROME Nuclear receptor coactivator 6, isoform F OS=Drosophila melanogaster OX=7227 GN=Ncoa6 PE=4 SV=2
8	Q9VMS2	5.19e-05	51.2	2265	0.013	0.012	Q9VMS2_DROME Nuclear receptor coactivator 6, isoform C OS=Drosophila melanogaster OX=7227 GN=Ncoa6 PE=4 SV=4
9	A0A8I5ZUN3	0.16	39.7	35375	0.041	0.002	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
10	A2ASS6	0.30	38.9	35213	0.031	0.002	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
11	Q8WZ42	1.5	36.6	34350	0.012	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
12	F1MB71	6.6	34.3	1361	0.015	0.022	F1MB71_BOVIN CASK interacting protein 1 OS=Bos taurus OX=9913 GN=CASKIN1 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13820 Nucleic_acid_bd	3.2e-51	184.4	Putative nucleic acid-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363929

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000384048	0.997	PAX-interacting protein 1
2	9606.ENSP00000264515	0.995	Retinoblastoma-binding protein 5
3	9606.ENSP00000367203	0.995	Lysine-specific demethylase 6A
4	9606.ENSP00000340896	0.994	Set1/Ash2 histone methyltransferase complex subunit ASH2
5	9606.ENSP00000262189	0.993	Histone-lysine N-methyltransferase 2C
6	9606.ENSP00000351446	0.991	WD repeat-containing protein 5
7	9606.ENSP00000301067	0.979	Histone-lysine N-methyltransferase 2D
8	9606.ENSP00000262367	0.975	CREB-binding protein
9	9606.ENSP00000254066	0.966	Retinoic acid receptor alpha
10	9606.ENSP00000260129	0.965	Trimethylguanosine synthase
11	9606.ENSP00000419692	0.965	Retinoic acid receptor RXR-alpha
12	9606.ENSP00000398837	0.950	Histone-lysine N-methyltransferase 2B
13	9606.ENSP00000385216	0.947	Nuclear receptor coactivator 1
14	9606.ENSP00000405330	0.934	Estrogen receptor
15	9606.ENSP00000263253	0.931	Histone acetyltransferase p300
16	9606.ENSP00000311747	0.929	RNA-binding protein 14
17	9606.ENSP00000320147	0.920	Histone-lysine N-methyltransferase EZH2
18	9606.ENSP00000301645	0.913	Cholesterol 7-alpha-monooxygenase
19	9606.ENSP00000363868	0.913	ATP-binding cassette sub-family A member 1
20	9606.ENSP00000222002	0.912	Bile salt sulfotransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003713	1.000	transcription coactivator activity
GO:0016922	1.000	nuclear receptor binding
GO:0046966	0.943	nuclear thyroid hormone receptor binding
GO:0003682	0.942	chromatin binding
GO:0042974	0.942	nuclear retinoic acid receptor binding
GO:0030374	0.941	nuclear receptor coactivator activity
GO:0030331	0.929	nuclear estrogen receptor binding
GO:0046965	0.898	nuclear retinoid X receptor binding
GO:0019899	0.726	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.987	regulation of biological process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.983	primary metabolic process
GO:0009987	0.979	cellular process
GO:0045944	0.977	positive regulation of transcription by RNA polymerase II
GO:0044237	0.971	cellular metabolic process
GO:0006807	0.959	nitrogen compound metabolic process
GO:0043170	0.945	macromolecule metabolic process
GO:0050896	0.917	response to stimulus
GO:0051716	0.791	cellular response to stimulus
GO:0032502	0.782	developmental process
GO:1901360	0.780	organic cyclic compound metabolic process
GO:0042221	0.761	response to chemical
GO:0034641	0.614	cellular nitrogen compound metabolic process
GO:0010033	0.545	response to organic substance
GO:1901564	0.514	organonitrogen compound metabolic process
GO:1901576	0.501	organic substance biosynthetic process
GO:0006139	0.501	nucleobase-containing compound metabolic process
GO:0090304	0.491	nucleic acid metabolic process
GO:0044249	0.484	cellular biosynthetic process
GO:0048856	0.480	anatomical structure development
GO:0006950	0.459	response to stress
GO:0010467	0.442	gene expression
GO:1901362	0.413	organic cyclic compound biosynthetic process
GO:0016070	0.388	RNA metabolic process
GO:0009719	0.379	response to endogenous stimulus
GO:0034654	0.377	nucleobase-containing compound biosynthetic process
GO:0006351	0.352	DNA-templated transcription
GO:0009725	0.340	response to hormone
GO:0033554	0.339	cellular response to stress
GO:0019538	0.326	protein metabolic process
GO:0036211	0.301	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.932	protein-containing complex
GO:0005667	0.788	transcription regulator complex
GO:0005737	0.732	cytoplasm
GO:0005829	0.432	cytosol
GO:1990234	0.336	transferase complex
GO:0140513	0.320	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]