StarFunc result for job id Q14687

User Input

>input (1217 residues)
MKGMSHEPKSPSLGMLSTATRTTATVNPLTPSPLNGALVPSGSPATSSALSAQAAPSSSF
AAALRKLAKQAEEPRGSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPST
PPVVTIAPTKTVNGVWRSESRQDAGSRSSSGGRERLIVEPPLPQEKAGGPAIPSHLLSTP
YPFGLSPSSVVQDSRFPPLNLQRPVHHVVPPSTVTEDYLRSFRPYHTTDDLRMSSLPPLG
LDPATAAAYYHPSYLAPHPFPHPAFRMDDSYCLSALRSPFYPIPTPGSLPPLHPSAMHLH
LSGVRYPPELSHSSLAALHSERMSGLSAERLQMDEELRREREREREREREREADREREKE
REREREKEREQEKEREREKERERELERQREQRAREKELLAAKALEPSFLPVAELHGLRGH
ATEERGKPSEQLTPTRAEKLKDAGLQAPKPVQHPLHPVPTPHHTVPSLISNHGIFSLPSS
SAATALLIQRTNEEEKWLARQRRLRQEKEDRQSQVSEFRQQVLEQHLDMGRPPVPAEAEH
RPESTTRPGPNRHEPGGRDPPQHFGGPPPLISPKPQLHAAPTALWNPVSLMDNTLETRRA
ESHSLHSHPAAFEPSRQAAVPLVKVERVFCPEKAEEGPRKREPAPLDKYQPPPPPPREGG
SLEHQPFLPGPGPFLAELEKSTQTILGQQRASLPQAATFGELSGPLKPGSPYRPPVPRAP
DPAYIYDEFLQQRRRLVSKLDLEERRRREAQEKGYYYDLDDSYDESDEEEVRAHLRCVAE
QPPLKLDTSSEKLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPTIQSKRQTPS
PRLALSTRYSPDEMNNSPNFEEKKKFLTIFNLTHISAEKRKDKERLVEMLRAMKQKALSA
AVADSLTNSPRDSPAVSLSEPATQQASLDVEKPVGVAASLSDIPKAAEPGKLEQVRPQEL
SRVQELAPASGEKARLSEAPGGKKSLSMLHYIRGAAPKDIPVPLSHSTNGKSKPWEPFVA
EEFAHQFHESVLQSTQKALQKHKGSVAVLSAEQNHKVDTSVHYNIPELQSSSRAPPPQHN
GQQEPPTARKGPPTQELDRDSEEEEEEDDEDGEDEEEVPKRKWQGIEAVFEAYQEHIEEQ
NLERQVLQTQCRRLEARHYSLSLTAEQLSHSVAELRSQKQKMVSERERLQAELDHLRKCL
ALPAMHWPRGYLKGYPR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14687	1.000	1.000	0.000	1217	1.000	1.000	Q14687.pdb.gz	GSE1_HUMAN Genetic suppressor element 1 OS=Homo sapiens OX=9606 GN=GSE1 PE=1 SV=3
2	AFDB:Q9VZT8	0.048	0.043	1.507E-6	1443	0.123	0.104	Q9VZT8.pdb.gz	Q9VZT8_DROME Myomesin and myosin binding protein OS=Drosophila melanogaster OX=7227 GN=MnM PE=4 SV=3
3	AFDB:Q8JGS1	0.030	0.030	1.724E-6	1263	0.120	0.116	Q8JGS1.pdb.gz	STIL_DANRE SCL-interrupting locus protein homolog OS=Danio rerio OX=7955 GN=stil PE=1 SV=2
4	AFDB:Q9NYF8	0.036	0.045	2.757E-6	920	0.121	0.160	Q9NYF8.pdb.gz	BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2
5	AFDB:Q8IRB5	0.039	0.034	2.063E-5	1465	0.137	0.114	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
6	AFDB:Q6AI39	0.040	0.043	1.180E-4	1079	0.120	0.135	Q6AI39.pdb.gz	BICRL_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein-like OS=Homo sapiens OX=9606 GN=BICRAL PE=1 SV=2
7	AFDB:A0A1D5NSI1	0.038	0.030	2.308E-4	1996	0.170	0.104	A0A1D5NSI1.pdb.gz
8	AFDB:A8JV11	0.043	0.043	6.750E-4	1213	0.124	0.124	A8JV11.pdb.gz	A8JV11_DROME Uncharacterized protein, isoform L OS=Drosophila melanogaster OX=7227 GN=Cph PE=4 SV=3
9	AFDB:Q8K1M4	0.062	0.083	9.440E-4	789	0.116	0.179	Q8K1M4.pdb.gz	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2
10	AFDB:E9PFQ4	0.071	0.075	1.010E-3	1115	0.159	0.174	E9PFQ4.pdb.gz	E9PFQ4_HUMAN Pleckstrin homology like domain family B member 2 (Fragment) OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=1
11	PDB:7mqaSS	0.025	0.063	5.248E-1	350	0.030	0.103	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6yxxAR	0.030	0.116	3.672	267	0.013	0.060	6yxxAR.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
13	PDB:6lss4	0.031	0.050	4.199	620	0.030	0.058	6lss4.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
14	PDB:7r5jA0	0.037	0.050	4.802	818	0.023	0.034	7r5jA0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
15	PDB:7mq8NE	0.029	0.218	6.715	100	0.015	0.180	7mq8NE.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:6j6gc	0.026	0.053	8.212	436	0.029	0.080	6j6gc.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
17	PDB:6qdvO	0.032	0.067	8.782	441	0.022	0.061	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
18	PDB:7mq8SY	0.032	0.118	8.782	238	0.016	0.084	7mq8SY.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:4fxeB	0.032	0.269	9.391	78	0.005	0.077	4fxeB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14687	0.0	2429	1217	1.000	1.000	GSE1_HUMAN Genetic suppressor element 1 OS=Homo sapiens OX=9606 GN=GSE1 PE=1 SV=3
2	Q6PGZ3	1.15e-06	55.5	629	0.022	0.043	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
3	F1QBY1	3.57e-06	54.3	2876	0.021	0.009	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
4	Q9LFE0	6.91e-05	49.7	820	0.071	0.106	DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana OX=3702 GN=DOT2 PE=1 SV=1
5	O23212	1.18e-04	48.9	573	0.025	0.054	U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana OX=3702 GN=U2AF65A PE=1 SV=2
6	F4JQG2	1.24e-04	48.5	551	0.025	0.056	F4JQG2_ARATH Splicing factor U2af large subunit OS=Arabidopsis thaliana OX=3702 GN=ATU2AF65A PE=1 SV=1
7	M9ND00	0.001	45.4	1190	0.030	0.030	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
8	M9PBF6	0.001	45.8	1088	0.030	0.033	M9PBF6_DROME Dynamin associated protein 160, isoform G OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
9	M9PDC7	0.001	45.8	1005	0.030	0.036	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
10	O61618	0.001	45.8	1094	0.030	0.033	O61618_DROME Dynamin associated protein isoform Dap160-1 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
11	O61639	0.001	45.4	1011	0.030	0.036	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
12	Q1WWC9	0.001	45.8	1096	0.030	0.033	Q1WWC9_DROME Dynamin associated protein 160, isoform C OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
13	Q8INU2	0.001	45.4	1014	0.030	0.036	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
14	Q9VIF7	0.001	45.8	1097	0.030	0.033	Q9VIF7_DROME Dynamin associated protein 160, isoform A OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
15	Q4QRG7	0.002	44.7	434	0.028	0.078	Q4QRG7_DANRE RNA-binding motif protein, X-linked 2 OS=Danio rerio OX=7955 GN=zgc:113884 PE=2 SV=1
16	Q66K09	0.006	42.7	374	0.015	0.048	Q66K09_MOUSE 5830443L24Rik protein (Fragment) OS=Mus musculus OX=10090 GN=Gbp8 PE=2 SV=1
17	Q8IDX6	0.010	42.7	3130	0.028	0.011	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
18	Q8SX83	0.012	42.7	5560	0.023	0.005	SPEN_DROME Protein split ends OS=Drosophila melanogaster OX=7227 GN=spen PE=1 SV=2
19	F1RAH8	0.018	41.6	450	0.035	0.093	F1RAH8_DANRE RNA-binding motif protein X-linked 2 OS=Danio rerio OX=7955 GN=im:7141316 PE=4 SV=1
20	Q8C761	0.019	41.6	999	0.023	0.028	DC2I1_MOUSE Cytoplasmic dynein 2 intermediate chain 1 OS=Mus musculus OX=10090 GN=Dync2i1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12540 DUF3736	1.7e-56	201.4	Protein of unknown function (DUF3736)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253458

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371133	0.914	High mobility group protein 20A
2	9606.ENSP00000328269	0.887	High mobility group 20B
3	9606.ENSP00000413929	0.817	REST corepressor 3
4	9606.ENSP00000244050	0.807	Zinc finger protein SNAI1
5	9606.ENSP00000430432	0.799	Histone deacetylase 2
6	9606.ENSP00000284245	0.795	Uncharacterized protein C16orf74
7	9606.ENSP00000383042	0.778	Lysine-specific histone demethylase 1A
8	9606.ENSP00000253457	0.774	ER membrane protein complex subunit 8
9	9606.ENSP00000362649	0.743	Histone deacetylase 1
10	9606.ENSP00000253462	0.704	DNA replication complex GINS protein PSF2
11	9606.ENSP00000336721	0.686	La-related protein 1
12	9606.ENSP00000371594	0.681	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7
13	9606.ENSP00000480791	0.637	Fibroblast growth factor 1
14	9606.ENSP00000254508	0.629	Nuclear pore membrane glycoprotein 210
15	9606.ENSP00000261749	0.623	AN1-type zinc finger protein 6
16	9606.ENSP00000457513	0.569	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial
17	9606.ENSP00000460070	0.566	General transcription factor II-I
18	9606.ENSP00000479904	0.544	Zinc finger MYM-type protein 2
19	9606.ENSP00000356218	0.512	NADH-cytochrome b5 reductase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.994	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0009987	0.968	cellular process
GO:0019222	0.964	regulation of metabolic process
GO:0060255	0.938	regulation of macromolecule metabolic process
GO:0051171	0.911	regulation of nitrogen compound metabolic process
GO:0080090	0.816	regulation of primary metabolic process
GO:0031324	0.781	negative regulation of cellular metabolic process
GO:0051172	0.763	negative regulation of nitrogen compound metabolic process
GO:0010605	0.742	negative regulation of macromolecule metabolic process
GO:0009889	0.727	regulation of biosynthetic process
GO:0045934	0.722	negative regulation of nucleobase-containing compound metabolic process
GO:0010468	0.716	regulation of gene expression
GO:0051252	0.707	regulation of RNA metabolic process
GO:0051253	0.704	negative regulation of RNA metabolic process
GO:0010556	0.686	regulation of macromolecule biosynthetic process
GO:0031326	0.686	regulation of cellular biosynthetic process
GO:2001141	0.675	regulation of RNA biosynthetic process
GO:0006355	0.656	regulation of DNA-templated transcription
GO:0048518	0.537	positive regulation of biological process
GO:0048522	0.462	positive regulation of cellular process
GO:0031327	0.457	negative regulation of cellular biosynthetic process
GO:0031325	0.379	positive regulation of cellular metabolic process
GO:0051173	0.378	positive regulation of nitrogen compound metabolic process
GO:0010604	0.374	positive regulation of macromolecule metabolic process
GO:0023051	0.373	regulation of signaling
GO:0010646	0.373	regulation of cell communication
GO:0048583	0.371	regulation of response to stimulus
GO:0071840	0.340	cellular component organization or biogenesis
GO:0008152	0.327	metabolic process
GO:0006357	0.312	regulation of transcription by RNA polymerase II
GO:0016043	0.300	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.890	cytoplasm
GO:0016020	0.393	membrane
GO:0043232	0.346	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]