StarFunc result for job id Q14689

User Input

>input (1571 residues)
MADRGCPLEAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSL
QAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRR
SVLVHSSVETYTPPDTSSASEDEGSLRRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSA
SSTSSHPGGRPTTAPSAAATPGAAATTALAGLEAHTHIDLHSAPPDVTTGLVEHSYFERP
QVASVRSVPRGCSGSMLETADGVPVNSRVSSKIQQLLNTLKRPKRPPLKEFFVDDFEELL
EVQQPDPNQPKPEGSETSVLRGEPLTAGVPRPPSLLATLQRWGTTQPKSPCLTALDTTGK
AVYTLTYGKLWSRSLKLAYTLLNKLTSKNEPLLKPGDRVALVFPNSDPVMFMVAFYGCLL
AELVPVPIEVPLTRKDAGSQQVGFLLGSCGVFLALTTDACQKGLPKAQTGEVAAFKGWPP
LSWLVIDGKHLAKPPKDWHPLAQDTGTGTAYIEYKTSKEGSTVGVTVSHASLLAQCRALT
QACGYSEAETLTNVLDFKRDAGLWHGVLTSVMNRMHVVSVPYALMKANPLSWIQKVCFYK
ARAALVKSRDMHWSLLAQRGQRDVSLSSLRMLIVADGANPWSISSCDAFLNVFQSRGLRP
EVICPCASSPEALTVAIRRPPDLGGPPPRKAVLSMNGLSYGVIRVDTEEKLSVLTVQDVG
QVMPGANVCVVKLEGTPYLCKTDEVGEICVSSSATGTAYYGLLGITKNVFEAVPVTTGGA
PIFDRPFTRTGLLGFIGPDNLVFIVGKLDGLMVTGVRRHNADDVVATALAVEPMKFVYRG
RIAVFSVTVLHDDRIVLVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTL
PKAPLGGIHISETKQRFLEGTLHPCNVLMCPHTCVTNLPKPRQKQPEVGPASMIVGNLVA
GKRIAQASGRELAHLEDSDQARKFLFLADVLQWRAHTTPDHPLFLLLNAKGTVTSTATCV
QLHKRAERVAAALMEKGRLSVGDHVALVYPPGVDLIAAFYGCLYCGCVPVTVRPPHPQNL
GTTLPTVKMIVEVSKSACVLTTQAVTRLLRSKEAAAAVDIRTWPTILDTDDIPKKKIASV
FRPPSPDVLAYLDFSVSTTGILAGVKMSHAATSALCRSIKLQCELYPSRQIAICLDPYCG
LGFALWCLCSVYSGHQSVLVPPLELESNVSLWLSAVSQYKARVTFCSYSVMEMCTKGLGA
QTGVLRMKGVNLSCVRTCMVVAEERPRIALTQSFSKLFKDLGLPARAVSTTFGCRVNVAI
CLQGTAGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVKVIIAHTETKGP
LGDSHLGEIWVSSPHNATGYYTVYGEEALHADHFSARLSFGDTQTIWARTGYLGFLRRTE
LTDASGGRHDALYVVGSLDETLELRGMRYHPIDIETSVIRAHRSIAECAVFTWTNLLVVV
VELDGLEQDALDLVALVTNVVLEEHYLVVGVVVIVDPGVIPINSRGEKQRMHLRDGFLAD
QLDPIYVAYNM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14689	1.000	1.000	0.000	1571	1.000	1.000	Q14689.pdb.gz	DIP2A_HUMAN Disco-interacting protein 2 homolog A OS=Homo sapiens OX=9606 GN=DIP2A PE=1 SV=2
2	PDB:5hm3A	0.326	0.786	2.794E-35	625	0.082	0.206	5hm3A.pdb.gz	Structure of the Essential Mtb FadD32 Enzyme: A Promising Drug Target for Treating Tuberculosis.
3	PDB:3r44A	0.258	0.718	1.007E-25	502	0.062	0.193	3r44A.pdb.gz	The Mycobacterium tuberculosis Very-Long-Chain Fatty Acyl-CoA Synthetase: Structural Basis for Housing Lipid Substrates Longer than the Enzyme.
4	PDB:1ultA	0.245	0.643	1.180E-25	533	0.068	0.201	1ultA.pdb.gz
5	PDB:7kydA	0.270	0.720	2.000E-25	534	0.064	0.189	7kydA.pdb.gz	FruitFire: a luciferase based on a fruit fly metabolic enzyme.
6	PDB:6q2mA	0.269	0.706	8.763E-25	544	0.057	0.165	6q2mA.pdb.gz	Mutagenesis and Structural Studies Reveal the Basis for the Activity and Stability Properties That Distinguish thePhotinusLuciferasesscintillansandpyralis.
7	PDB:5ja2A	0.239	0.297	1.566E-24	1238	0.062	0.078	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
8	PDB:5bsmA	0.268	0.709	2.149E-24	530	0.068	0.202	5bsmA.pdb.gz	Structural Basis for Specificity and Flexibility in a Plant 4-Coumarate:CoA Ligase.
9	PDB:3b7wA	0.240	0.638	5.271E-24	537	0.060	0.175	3b7wA.pdb.gz	Structural snapshots for the conformation-dependent catalysis by human medium-chain acyl-coenzyme A synthetase ACSM2A.
10	PDB:5ie2A	0.272	0.764	6.175E-24	506	0.066	0.204	5ie2A.pdb.gz	Crystal Structures of Arabidopsis thaliana Oxalyl-CoA Synthetase Essential for Oxalate Degradation
11	PDB:2p20A	0.238	0.539	7.234E-24	641	0.063	0.154	2p20A.pdb.gz	Biochemical and Crystallographic Analysis of Substrate Binding and Conformational Changes in Acetyl-CoA Synthetase.
12	AFDB:Q96P26	0.051	0.091	1.751E-1	610	0.050	0.128	Q96P26.pdb.gz	5NT1B_HUMAN Cytosolic 5'-nucleotidase 1B OS=Homo sapiens OX=9606 GN=NT5C1B PE=2 SV=2
13	AFDB:Q9VHP0	0.057	0.095	4.295E-1	798	0.050	0.098	Q9VHP0.pdb.gz	DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster OX=7227 GN=bel PE=1 SV=1
14	AFDB:Q4QF51	0.032	0.057	5.032E-1	831	0.030	0.057	Q4QF51.pdb.gz	Q4QF51_LEIMA MGT1 magnesium transporter OS=Leishmania major OX=5664 GN=MGT1 PE=3 SV=1
15	AFDB:Q9UNY4	0.044	0.056	6.551E-1	1162	0.053	0.071	Q9UNY4.pdb.gz	TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens OX=9606 GN=TTF2 PE=1 SV=2
16	AFDB:P26358	0.026	0.026	6.906E-1	1616	0.038	0.037	P26358.pdb.gz	DNMT1_HUMAN DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2
17	AFDB:Q1ZXQ0	0.058	0.073	1.301	1019	0.049	0.076	Q1ZXQ0.pdb.gz	PHR_DICDI Sca1 complex protein phr OS=Dictyostelium discoideum OX=44689 GN=phr PE=1 SV=1
18	AFDB:D4AIA8	0.046	0.081	1.524	784	0.056	0.112	D4AIA8.pdb.gz	D4AIA8_ASPOZ AAA ATPase OS=Aspergillus oryzae OX=5062 GN=aipA PE=4 SV=1
19	AFDB:Q9Z330	0.028	0.027	1.607	1622	0.041	0.040	Q9Z330.pdb.gz	DNMT1_RAT DNA (cytosine-5)-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Dnmt1 PE=1 SV=2
20	AFDB:Q8C0E5	0.036	0.091	1.785	555	0.050	0.141	Q8C0E5.pdb.gz	Q8C0E5_MOUSE SEFIR domain-containing protein OS=Mus musculus OX=10090 GN=Traf3ip2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14689	0.0	3222	1571	1.000	1.000	DIP2A_HUMAN Disco-interacting protein 2 homolog A OS=Homo sapiens OX=9606 GN=DIP2A PE=1 SV=2
2	Q3UH60	0.0	2279	1574	0.717	0.715	DIP2B_MOUSE Disco-interacting protein 2 homolog B OS=Mus musculus OX=10090 GN=Dip2b PE=1 SV=1
3	Q8BWT5	0.0	2844	1523	0.913	0.942	DIP2A_MOUSE Disco-interacting protein 2 homolog A OS=Mus musculus OX=10090 GN=Dip2a PE=1 SV=3
4	Q9P265	0.0	2286	1576	0.721	0.718	DIP2B_HUMAN Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3
5	Q9W0S9	0.0	1623	1773	0.561	0.497	DIP2_DROME Disco-interacting protein 2 OS=Drosophila melanogaster OX=7227 GN=DIP2 PE=1 SV=2
6	Q10250	2.27e-72	270	1517	0.239	0.248	YD22_SCHPO Uncharacterized protein C56F8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC56F8.02 PE=4 SV=1
7	P95141	1.97e-33	140	619	0.100	0.254	FAA29_MYCTU 4-hydroxyphenylalkanoate adenylyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD29 PE=1 SV=1
8	Q09773	1.32e-31	137	1487	0.186	0.196	MUG62_SCHPO Meiotically up-regulated gene 62 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug62 PE=1 SV=2
9	Q9I157	1.54e-30	134	4342	0.092	0.033	Q9I157_PSEAE PvdL OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdL PE=4 SV=1
10	P9WQ49	6.00e-26	117	578	0.091	0.247	FAD21_MYCTU Putative fatty-acid--CoA ligase FadD21 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD21 PE=1 SV=1
11	P9WQ57	4.85e-25	114	585	0.094	0.251	FAA30_MYCTU Probable long-chain-fatty-acid--AMP ligase FadD30 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD30 PE=1 SV=1
12	P9WQ59	5.16e-24	111	580	0.094	0.253	FAA28_MYCTU Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD28 PE=1 SV=1
13	Q7TXM1	6.61e-24	110	583	0.094	0.252	FAA26_MYCBO Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=fadD26 PE=1 SV=1
14	P9WQ45	1.39e-23	109	583	0.092	0.247	FAD25_MYCTU Putative fatty-acid--CoA ligase fadD25 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD25 PE=1 SV=1
15	P9WQ43	1.40e-23	109	583	0.093	0.250	FAA26_MYCTU Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD26 PE=1 SV=1
16	Q12275	8.44e-23	108	1648	0.103	0.098	YO093_YEAST Uncharacterized protein YOR093C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR093C PE=1 SV=1
17	P9WQ47	4.38e-21	102	584	0.086	0.231	FAA23_MYCTU Long-chain-fatty-acid--AMP ligase FadD23 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD23 PE=1 SV=1
18	O53580	1.22e-19	97.8	637	0.080	0.196	FAA32_MYCTU Long-chain-fatty-acid--AMP ligase FadD32 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fadD32 PE=1 SV=1
19	Q9VDU3	1.16e-07	58.9	546	0.036	0.104	Q9VDU3_DROME RE32325p OS=Drosophila melanogaster OX=7227 GN=Acsx1R PE=2 SV=2
20	Q9VDU4	1.50e-07	58.5	537	0.036	0.106	Q9VDU4_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Acsx1L PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00501 AMP-binding	7.4e-92	319.8	AMP-binding enzyme
2	PF06464 DMAP_binding	3e-32	123.1	DMAP1-binding Domain
3	PF05120 GvpG	17	16.9	Gas vesicle protein G

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392066

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295633	0.989	Follistatin-related protein 1
2	9606.ENSP00000322775	0.806	Inactive rhomboid protein 2
3	9606.ENSP00000256759	0.644	Follistatin
4	9606.ENSP00000380759	0.602	Protein arginine N-methyltransferase 2
5	9606.ENSP00000291539	0.563	High affinity cGMP-specific 3',5'-cyclic phosphodiesterase 9A
6	9606.ENSP00000323275	0.535	Dynein assembly factor 4, axonemal
7	9606.ENSP00000381768	0.526	Cadherin-23
8	9606.ENSP00000329614	0.521	Endoribonuclease YbeY
9	9606.ENSP00000321853	0.516	Alpha-2-antiplasmin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.906	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.991	regulation of biological process
GO:0009987	0.988	cellular process
GO:0019222	0.978	regulation of metabolic process
GO:0016043	0.969	cellular component organization
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0048519	0.923	negative regulation of biological process
GO:0080090	0.851	regulation of primary metabolic process
GO:0050794	0.819	regulation of cellular process
GO:0051171	0.770	regulation of nitrogen compound metabolic process
GO:0048518	0.715	positive regulation of biological process
GO:0071704	0.603	organic substance metabolic process
GO:0044237	0.556	cellular metabolic process
GO:0044238	0.555	primary metabolic process
GO:0006807	0.528	nitrogen compound metabolic process
GO:0010468	0.519	regulation of gene expression
GO:0010605	0.467	negative regulation of macromolecule metabolic process
GO:0051246	0.452	regulation of protein metabolic process
GO:0032501	0.443	multicellular organismal process
GO:1901564	0.427	organonitrogen compound metabolic process
GO:0010604	0.399	positive regulation of macromolecule metabolic process
GO:0048523	0.391	negative regulation of cellular process
GO:0048856	0.362	anatomical structure development
GO:0051173	0.311	positive regulation of nitrogen compound metabolic process
GO:0031399	0.311	regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0016020	0.987	membrane
GO:0005634	0.949	nucleus
GO:0070013	0.866	intracellular organelle lumen
GO:0005576	0.839	extracellular region
GO:0071944	0.689	cell periphery
GO:0009986	0.651	cell surface
GO:0005886	0.651	plasma membrane
GO:0005829	0.616	cytosol
GO:0005615	0.548	extracellular space
GO:0031982	0.548	vesicle
GO:0120025	0.547	plasma membrane bounded cell projection
GO:0031981	0.546	nuclear lumen
GO:0005654	0.500	nucleoplasm
GO:0005739	0.446	mitochondrion
GO:0043005	0.405	neuron projection
GO:0012505	0.396	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]