StarFunc result for job id Q14690

User Input

>input (1871 residues)
MANLEESFPRGGTRKIHKPEKAFQQSVEQDNLFDISTEEGSTKRKKSQKGPAKTKKLKIE
KRESSKSAREKFEILSVESLCEGMRILGCVKEVNELELVISLPNGLQGFVQVTEICDAYT
KKLNEQVTQEQPLKDLLHLPELFSPGMLVRCVVSSLGITDRGKKSVKLSLNPKNVNRVLS
AEALKPGMLLTGTVSSLEDHGYLVDIGVDGTRAFLPLLKAQEYIRQKNKGAKLKVGQYLN
CIVEKVKGNGGVVSLSVGHSEVSTAIATEQQSWNLNNLLPGLVVKAQVQKVTPFGLTLNF
LTFFTGVVDFMHLDPKKAGTYFSNQAVRACILCVHPRTRVVHLSLRPIFLQPGRPLTRLS
CQNLGAVLDDVPVQGFFKKAGATFRLKDGVLAYARLSHLSDSKNVFNPEAFKPGNTHKCR
IIDYSQMDELALLSLRTSIIEAQYLRYHDIEPGAVVKGTVLTIKSYGMLVKVGEQMRGLV
PPMHLADILMKNPEKKYHIGDEVKCRVLLCDPEAKKLMMTLKKTLIESKLPVITCYADAK
PGLQTHGFIIRVKDYGCIVKFYNNVQGLVPKHELSTEYIPDPERVFYTGQVVKVVVLNCE
PSKERMLLSFKLSSDPEPKKEPAGHSQKKGKAINIGQLVDVKVLEKTKDGLEVAVLPHNI
RAFLPTSHLSDHVANGPLLHHWLQAGDILHRVLCLSQSEGRVLLCRKPALVSTVEGGQDP
KNFSEIHPGMLLIGFVKSIKDYGVFIQFPSGLSGLAPKAIMSDKFVTSTSDHFVEGQTVA
AKVTNVDEEKQRMLLSLRLSDCGLGDLAITSLLLLNQCLEELQGVRSLMSNRDSVLIQTL
AEMTPGMFLDLVVQEVLEDGSVVFSGGPVPDLVLKASRYHRAGQEVESGQKKKVVILNVD
LLKLEVHVSLHQDLVNRKARKLRKGSEHQAIVQHLEKSFAIASLVETGHLAAFSLTSHLN
DTFRFDSEKLQVGQGVSLTLKTTEPGVTGLLLAVEGPAAKRTMRPTQKDSETVDEDEEVD
PALTVGTIKKHTLSIGDMVTGTVKSIKPTHVVVTLEDGIIGCIHASHILDDVPEGTSPTT
KLKVGKTVTARVIGGRDMKTFKYLPISHPRFVRTIPELSVRPSELEDGHTALNTHSVSPM
EKIKQYQAGQTVTCFLKKYNVVKKWLEVEIAPDIRGRIPLLLTSLSFKVLKHPDKKFRVG
QALRATVVGPDSSKTLLCLSLTGPHKLEEGEVAMGRVVKVTPNEGLTVSFPFGKIGTVSI
FHMSDSYSETPLEDFVPQKVVRCYILSTADNVLTLSLRSSRTNPETKSKVEDPEINSIQD
IKEGQLLRGYVGSIQPHGVFFRLGPSVVGLARYSHVSQHSPSKKALYNKHLPEGKLLTAR
VLRLNHQKNLVELSFLPGDTGKPDVLSASLEGQLTKQEERKTEAEERDQKGEKKNQKRNE
KKNQKGQEEVEMPSKEKQQPQKPQAQKRGGRECRESGSEQERVSKKPKKAGLSEEDDSLV
DVYYREGKEEAEETNVLPKEKQTKPAEAPRLQLSSGFAWNVGLDSLTPALPPLAESSDSE
EDEKPHQATIKKSKKERELEKQKAEKELSRIEEALMDPGRQPESADDFDRLVLSSPNSSI
LWLQYMAFHLQATEIEKARAVAERALKTISFREEQEKLNVWVALLNLENMYGSQESLTKV
FERAVQYNEPLKVFLHLADIYAKSEKFQEAGELYNRMLKRFRQEKAVWIKYGAFLLRRSQ
AAASHRVLQRALECLPSKEHVDVIAKFAQLEFQLGDAERAKAIFENTLSTYPKRTDVWSV
YIDMTIKHGSQKDVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKALE
YVEAKSSVLED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F4J8K6	0.390	0.382	0.000	1920	0.283	0.276	F4J8K6.pdb.gz	RRP5_ARATH rRNA biogenesis protein RRP5 OS=Arabidopsis thaliana OX=3702 GN=RRP5 PE=2 SV=2
2	AFDB:Q05022	0.263	0.283	0.000	1729	0.226	0.244	Q05022.pdb.gz	RRP5_YEAST rRNA biogenesis protein RRP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP5 PE=1 SV=1
3	AFDB:Q14690	1.000	1.000	0.000	1871	1.000	1.000	Q14690.pdb.gz	RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3
4	AFDB:Q6NS46	0.474	0.476	0.000	1862	0.803	0.807	Q6NS46.pdb.gz	RRP5_MOUSE Protein RRP5 homolog OS=Mus musculus OX=10090 GN=Pdcd11 PE=1 SV=2
5	AFDB:Q4GZ82	0.145	0.375	1.723E-30	679	0.090	0.249	Q4GZ82.pdb.gz	Q4GZ82_TRYB2 rRNA biogenesis protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1370 PE=4 SV=1
6	AFDB:P9WH43	0.074	0.194	3.003E-20	481	0.038	0.148	P9WH43.pdb.gz	RS1_MYCTU Small ribosomal subunit protein bS1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpsA PE=1 SV=1
7	PDB:6lqqRD	0.134	0.754	5.640E-18	316	0.066	0.392	6lqqRD.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
8	PDB:6h4ny	0.065	0.228	3.270E-10	351	0.030	0.160	6h4ny.pdb.gz	Structure of a hibernating 100S ribosome reveals an inactive conformation of the ribosomal protein S1.
9	PDB:6iczJ	0.111	0.300	1.629E-7	571	0.025	0.082	6iczJ.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
10	PDB:8a3tD	0.082	0.228	5.203E-7	560	0.021	0.070	8a3tD.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
11	PDB:6j6gd	0.098	0.249	6.698E-7	566	0.030	0.101	6j6gd.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
12	PDB:7ntfA	0.081	0.140	7.045E-7	918	0.022	0.046	7ntfA.pdb.gz
13	PDB:6bk8T	0.106	0.283	1.502E-6	483	0.029	0.114	6bk8T.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
14	AFDB:Q28056	0.075	0.151	2.287E-6	754	0.035	0.088	Q28056.pdb.gz	ASPH_BOVIN Aspartyl/asparaginyl beta-hydroxylase OS=Bos taurus OX=9913 GN=ASPH PE=1 SV=1
15	PDB:8d0bA	0.055	0.062	2.618E-6	1116	0.067	0.112	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
16	AFDB:Q8BSY0	0.073	0.154	2.798E-6	741	0.034	0.086	Q8BSY0.pdb.gz	ASPH_MOUSE Aspartyl/asparaginyl beta-hydroxylase OS=Mus musculus OX=10090 GN=Asph PE=1 SV=1
17	PDB:6uroE	0.111	0.347	3.545E-6	527	0.028	0.099	6uroE.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.
18	AFDB:Q12797	0.073	0.150	3.789E-6	758	0.035	0.087	Q12797.pdb.gz	ASPH_HUMAN Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH PE=1 SV=3
19	PDB:7qe7U	0.079	0.217	3.922E-6	540	0.023	0.080	7qe7U.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
20	AFDB:O94462	0.085	0.167	5.234E-5	732	0.040	0.102	O94462.pdb.gz	PUF3_SCHPO mRNA-binding protein puf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=puf3 PE=2 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F4J8K6	0.0	699	1920	0.300	0.292	RRP5_ARATH rRNA biogenesis protein RRP5 OS=Arabidopsis thaliana OX=3702 GN=RRP5 PE=2 SV=2
2	Q14690	0.0	3836	1871	1.000	1.000	RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3
3	Q6NS46	0.0	2982	1862	0.810	0.814	RRP5_MOUSE Protein RRP5 homolog OS=Mus musculus OX=10090 GN=Pdcd11 PE=1 SV=2
4	O74835	6.14e-80	295	1690	0.124	0.137	RRP5_SCHPO rRNA biogenesis protein rrp5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp5 PE=1 SV=1
5	Q05022	1.19e-77	288	1729	0.069	0.075	RRP5_YEAST rRNA biogenesis protein RRP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP5 PE=1 SV=1
6	Q9VC94	2.68e-60	231	1430	0.065	0.085	Q9VC94_DROME LD41803p OS=Drosophila melanogaster OX=7227 GN=Rrp5 PE=1 SV=2
7	Q4GZ82	4.22e-56	211	679	0.060	0.166	Q4GZ82_TRYB2 rRNA biogenesis protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1370 PE=4 SV=1
8	C3TGB2	7.29e-15	82.4	557	0.051	0.171	C3TGB2_ECOLX 30S ribosomal protein S1 OS=Escherichia coli OX=562 GN=rpsA PE=3 SV=1
9	P0AG67	7.29e-15	82.4	557	0.051	0.171	RS1_ECOLI Small ribosomal subunit protein bS1 OS=Escherichia coli (strain K12) OX=83333 GN=rpsA PE=1 SV=1
10	Q9Z8M3	2.80e-12	73.9	580	0.053	0.171	RS1_CHLPN Small ribosomal subunit protein bS1 OS=Chlamydia pneumoniae OX=83558 GN=rpsA PE=3 SV=1
11	P9WH43	9.09e-10	65.9	481	0.043	0.166	RS1_MYCTU Small ribosomal subunit protein bS1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rpsA PE=1 SV=1
12	Q9FNM3	1.75e-08	62.0	673	0.034	0.094	Q9FNM3_ARATH CRN (Crooked neck) protein OS=Arabidopsis thaliana OX=3702 GN=MCL19.3 PE=1 SV=1
13	F4JZX8	1.93e-07	58.5	705	0.028	0.074	F4JZX8_ARATH Crooked neck protein, putative / cell cycle protein OS=Arabidopsis thaliana OX=3702 GN=At5g41770 PE=1 SV=1
14	Q9BZJ0	2.77e-07	58.2	848	0.027	0.059	CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1 PE=1 SV=4
15	Q9SZD6	5.87e-07	57.4	953	0.028	0.055	PETS_ARATH Polyprotein of EF-Ts, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PETs PE=1 SV=1
16	P63155	7.37e-07	56.6	690	0.028	0.075	CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus OX=10116 GN=Crnkl1 PE=2 SV=1
17	Q9LKU3	2.68e-06	55.1	917	0.024	0.049	Q9LKU3_ARATH Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=T32B20.g PE=1 SV=1
18	P87312	3.04e-06	54.7	674	0.026	0.071	CLF1_SCHPO Pre-mRNA-splicing factor cwf4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf4 PE=1 SV=1
19	Q54XP4	5.17e-06	53.9	705	0.027	0.072	CRNL1_DICDI Crooked neck-like protein 1 OS=Dictyostelium discoideum OX=44689 GN=crnkl1 PE=3 SV=1
20	Q9LK47	5.21e-06	53.5	392	0.026	0.125	Q9LK47_ARATH AT3g23700/MYM9_3 OS=Arabidopsis thaliana OX=3702 GN=SRRP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09883 DUF2110	1.2e+02	13.6	Uncharacterized protein conserved in archaea (DUF2110)
2	PF01535 PPR	4.3e+02	12.6	PPR repeat
3	PF00575 S1	6.3e-67	233.2	S1 RNA binding domain
4	PF05843 Suf	6.1e-08	44.6	Suppressor of forked protein (Suf)
5	PF13424 TPR_12	2.2e+02	13.5	Tetratricopeptide repeat
6	PF13428 TPR_14	0.00069	31.2	Tetratricopeptide repeat
7	PF13429 TPR_15	73	14.2	Tetratricopeptide repeat
8	PF13432 TPR_16	4.1	19.4	Tetratricopeptide repeat
9	PF14559 TPR_19	0.00053	31.7	Tetratricopeptide repeat
10	PF13174 TPR_6	1.5e+02	14.4	Tetratricopeptide repeat
11	PF13176 TPR_7	5.1e+02	12.1	Tetratricopeptide repeat
12	PF13181 TPR_8	23	16.5	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358812

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229214	0.999	KRR1 small subunit processome component homolog
2	9606.ENSP00000232888	0.999	U3 small nucleolar RNA-interacting protein 2
3	9606.ENSP00000234170	0.999	CCAAT/enhancer-binding protein zeta
4	9606.ENSP00000244230	0.999	U3 small nucleolar ribonucleoprotein protein MPP10
5	9606.ENSP00000261637	0.999	Small subunit processome component 20 homolog
6	9606.ENSP00000297579	0.999	DDB1- and CUL4-associated factor 13
7	9606.ENSP00000297990	0.999	Nucleolar protein 6
8	9606.ENSP00000328854	0.999	Nucleolar complex protein 4 homolog
9	9606.ENSP00000355541	0.999	HEAT repeat-containing protein 1
10	9606.ENSP00000363642	0.999	Ribosome biogenesis protein BMS1 homolog
11	9606.ENSP00000363746	0.999	WD repeat-containing protein 46
12	9606.ENSP00000405068	0.999	Nucleolar protein 14
13	9606.ENSP00000479504	0.999	Probable ATP-dependent RNA helicase DDX52
14	9606.ENSP00000223073	0.998	RNA-binding protein 28
15	9606.ENSP00000230640	0.998	Superkiller viralicidic activity 2-like 2
16	9606.ENSP00000264279	0.998	Nucleolar protein 58
17	9606.ENSP00000308179	0.998	WD repeat-containing protein 3
18	9606.ENSP00000314193	0.998	WD repeat-containing protein 75
19	9606.ENSP00000327179	0.998	U3 small nucleolar RNA-associated protein 4 homolog
20	9606.ENSP00000370589	0.998	Nucleolar protein 56

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0051059	0.999	NF-kappaB binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0034641	0.991	cellular nitrogen compound metabolic process
GO:0043170	0.982	macromolecule metabolic process
GO:0006139	0.976	nucleobase-containing compound metabolic process
GO:0006396	0.972	RNA processing
GO:0034660	0.936	ncRNA metabolic process
GO:0022613	0.932	ribonucleoprotein complex biogenesis
GO:0042254	0.839	ribosome biogenesis
GO:0034470	0.804	ncRNA processing
GO:0048856	0.691	anatomical structure development
GO:0065007	0.650	biological regulation
GO:0050789	0.610	regulation of biological process
GO:0016072	0.515	rRNA metabolic process
GO:0006364	0.494	rRNA processing
GO:0032501	0.474	multicellular organismal process
GO:0050794	0.371	regulation of cellular process
GO:0019222	0.321	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.996	cytosol
GO:0005654	0.995	nucleoplasm
GO:0043232	0.933	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]