StarFunc result for job id Q14691

User Input

>input (196 residues)
MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIP
TIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSVLPNALRFHMAAEEMEWFNNYKRS
LATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRW
KCEQLIRQGVLEHILS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q14691	1.000	1.000	1.284E-35	196	1.000	1.000	Q14691.pdb.gz	PSF1_HUMAN DNA replication complex GINS protein PSF1 OS=Homo sapiens OX=9606 GN=GINS1 PE=1 SV=1
2	AFDB:Q7ZT47	0.982	0.982	2.318E-33	196	0.888	0.888	Q7ZT47.pdb.gz	PSF1_XENLA DNA replication complex GINS protein PSF1 OS=Xenopus laevis OX=8355 GN=gins1 PE=1 SV=1
3	PDB:6xtxA	0.928	0.928	1.148E-28	196	1.000	1.000	6xtxA.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
4	AFDB:Q9W0I7	0.942	0.915	5.072E-23	202	0.510	0.495	Q9W0I7.pdb.gz	Q9W0I7_DROME DNA replication complex GINS protein PSF1 OS=Drosophila melanogaster OX=7227 GN=Psf1 PE=1 SV=2
5	AFDB:Q9SSC0	0.915	0.893	3.748E-16	201	0.316	0.308	Q9SSC0.pdb.gz	Q9SSC0_ARATH At1g80190 OS=Arabidopsis thaliana OX=3702 GN=PSF1 PE=1 SV=1
6	AFDB:Q9P7X6	0.814	0.792	1.593E-13	202	0.301	0.292	Q9P7X6.pdb.gz	PSF1_SCHPO DNA replication complex GINS protein psf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psf1 PE=3 SV=1
7	AFDB:Q12488	0.836	0.792	1.855E-12	208	0.270	0.255	Q12488.pdb.gz	PSF1_YEAST DNA replication complex GINS protein PSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSF1 PE=1 SV=1
8	AFDB:Q38F51	0.821	0.821	1.624E-11	196	0.276	0.276	Q38F51.pdb.gz	Q38F51_TRYB2 GINS subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3540 PE=3 SV=1
9	PDB:6rawH	0.638	0.641	5.188E-11	195	0.536	0.538	6rawH.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
10	PDB:3jc5A	0.788	0.748	1.155E-7	208	0.255	0.240	3jc5A.pdb.gz
11	AFDB:Q582Q4	0.534	0.386	3.757E-7	283	0.184	0.127	Q582Q4.pdb.gz	Q582Q4_TRYB2 DNA replication complex GINS protein SLD5 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48K5.420 PE=3 SV=1
12	AFDB:Q6NQP5	0.519	0.467	6.281E-7	220	0.158	0.141	Q6NQP5.pdb.gz	SLD5_ARATH DNA replication complex GINS protein SLD5 OS=Arabidopsis thaliana OX=3702 GN=SLD5 PE=1 SV=1
13	AFDB:Q9P7C8	0.545	0.503	9.367E-7	214	0.158	0.145	Q9P7C8.pdb.gz	SLD5_SCHPO DNA replication complex GINS protein sld5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sld5 PE=1 SV=1
14	PDB:6xtxD	0.454	0.440	2.992E-6	203	0.194	0.187	6xtxD.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
15	PDB:6sklD	0.404	0.343	7.750E-5	243	0.122	0.099	6sklD.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
16	PDB:5mkkA	0.268	0.106	1.399E-2	593	0.133	0.044	5mkkA.pdb.gz
17	PDB:6raxN	0.442	0.421	4.912E-2	208	0.194	0.183	6raxN.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
18	PDB:5u1dA	0.195	0.092	9.746E-2	561	0.117	0.041	5u1dA.pdb.gz
19	PDB:5mkkB	0.223	0.090	1.725E-1	577	0.173	0.059	5mkkB.pdb.gz
20	PDB:3qf4B	0.212	0.090	3.423E-1	588	0.133	0.044	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14691	2.30e-147	409	196	1.000	1.000	PSF1_HUMAN DNA replication complex GINS protein PSF1 OS=Homo sapiens OX=9606 GN=GINS1 PE=1 SV=1
2	Q9CZ15	5.47e-141	392	196	0.934	0.934	PSF1_MOUSE DNA replication complex GINS protein PSF1 OS=Mus musculus OX=10090 GN=Gins1 PE=1 SV=1
3	Q7ZT47	1.58e-134	376	196	0.888	0.888	PSF1_XENLA DNA replication complex GINS protein PSF1 OS=Xenopus laevis OX=8355 GN=gins1 PE=1 SV=1
4	Q9W0I7	7.48e-74	223	202	0.520	0.505	Q9W0I7_DROME DNA replication complex GINS protein PSF1 OS=Drosophila melanogaster OX=7227 GN=Psf1 PE=1 SV=2
5	Q9SSC0	3.93e-24	96.3	201	0.311	0.303	Q9SSC0_ARATH At1g80190 OS=Arabidopsis thaliana OX=3702 GN=PSF1 PE=1 SV=1
6	Q9P7X6	1.36e-18	81.6	202	0.316	0.307	PSF1_SCHPO DNA replication complex GINS protein psf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psf1 PE=3 SV=1
7	Q12488	6.72e-14	69.3	208	0.270	0.255	PSF1_YEAST DNA replication complex GINS protein PSF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSF1 PE=1 SV=1
8	Q38F51	1.32e-07	52.0	196	0.270	0.270	Q38F51_TRYB2 GINS subunit domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3540 PE=3 SV=1
9	O51056	8.3	29.3	243	0.163	0.132	Y025_BORBU Probable transcriptional regulatory protein BB_0025 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0025 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05916 Sld5	2.2	20.2	GINS complex protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000019015

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000004159	0.998	GINS complex subunit 3 (Psf3 homolog)
2	61853.ENSNLEP00000004678	0.998	DNA helicase
3	61853.ENSNLEP00000013974	0.998	DNA helicase
4	61853.ENSNLEP00000015287	0.998	DNA replication complex GINS protein SLD5
5	61853.ENSNLEP00000016189	0.998	DNA helicase
6	61853.ENSNLEP00000017451	0.998	DNA helicase
7	61853.ENSNLEP00000006661	0.997	Cell division cycle 45
8	61853.ENSNLEP00000017168	0.996	DNA helicase
9	61853.ENSNLEP00000010722	0.995	DNA helicase
10	61853.ENSNLEP00000015520	0.995	WD repeat and HMG-box DNA binding protein 1
11	61853.ENSNLEP00000015666	0.988	Plays an important role in the control of DNA replication and the maintenance of replication fork stability.
12	61853.ENSNLEP00000014625	0.981	DNA polymerase epsilon subunit
13	61853.ENSNLEP00000016406	0.973	Uncharacterized protein
14	61853.ENSNLEP00000021231	0.959	Timeless circadian clock
15	61853.ENSNLEP00000002132	0.954	Cell division control protein
16	61853.ENSNLEP00000023993	0.952	Cyclin-dependent kinase 1
17	61853.ENSNLEP00000010613	0.946	Polymerase (DNA directed), epsilon, catalytic subunit
18	61853.ENSNLEP00000000286	0.937	Uncharacterized protein
19	61853.ENSNLEP00000011077	0.937	Origin recognition complex, subunit 5
20	61853.ENSNLEP00000013214	0.937	Minichromosome maintenance domain containing 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003682	0.896	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0006807	0.991	nitrogen compound metabolic process
GO:0043170	0.983	macromolecule metabolic process
GO:0006139	0.945	nucleobase-containing compound metabolic process
GO:0090304	0.911	nucleic acid metabolic process
GO:0006259	0.904	DNA metabolic process
GO:0050789	0.807	regulation of biological process
GO:0006260	0.762	DNA replication
GO:0006261	0.719	DNA-templated DNA replication
GO:0050794	0.669	regulation of cellular process
GO:0071840	0.423	cellular component organization or biogenesis
GO:0019222	0.420	regulation of metabolic process
GO:0080090	0.401	regulation of primary metabolic process
GO:0051171	0.400	regulation of nitrogen compound metabolic process
GO:0031323	0.398	regulation of cellular metabolic process
GO:0016043	0.397	cellular component organization
GO:0006996	0.367	organelle organization
GO:0060255	0.359	regulation of macromolecule metabolic process
GO:0048518	0.344	positive regulation of biological process
GO:0051276	0.336	chromosome organization
GO:0048522	0.318	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0000228	0.998	nuclear chromosome
GO:0000811	0.990	GINS complex
GO:0071162	0.983	CMG complex
GO:0005737	0.964	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]