StarFunc result for job id Q14692

User Input

>input (1282 residues)
MEAKDQKKHRKKNSGPKAAKKKKRLLQDLQLGDEEDARKRNPKAFAVQSAVRMARSFHRT
QDLKTKKHHIPVVDRTPLEPPPIVVVVMGPPKVGKSTLIQCLIRNFTRQKLTEIRGPVTI
VSGKKRRLTIIECGCDINMMIDLAKVADLVLMLIDASFGFEMETFEFLNICQVHGFPKIM
GVLTHLDSFKHNKQLKKTKKRLKHRFWTEVYPGAKLFYLSGMVHGEYQNQEIHNLGRFIT
VMKFRPLTWQTSHPYILADRMEDLTNPEDIRTNIKCDRKVSLYGYLRGAHLKNKSQIHMP
GVGDFAVSDISFLPDPCALPEQQKKRCLNEKEKLVYAPLSGVGGVLYDKDAVYVDLGGSH
VFQDEVGPTHELVQSLISTHSTIDAKMASSRVTLFSDSKPLGSEDIDNQGLMMPKEEKQM
DLNTGRMRRKAIFGDEDESGDSDDEEDDEMSEDDGLENGSSDEEAEEEENAEMTDQYMAV
KGIKRRKLELEEDSEMDLPAFADSDDDLERSSAEEGEAEEADESSEEEDCTAGEKGISGS
KAAGEGSKAGLSPANCQSDRVNLEKSLLMKKAALPTFDSGHCTAEEVFASEDESEESSSL
SAEEEDSENEEAIRKKLSKPSQVSSGQKLGPQNFIDETSDIENLLKEEEDYKEENNDSKE
TSGALKWKEDLSRKAAEAFLRQQQAAPNLRKLIYGTVTEDNEEEDDDTLEELGGLFRVNQ
PDRECKHKADSLDCSRFLVEAPHDWDLEEVMNSIRDCFVTGKWEDDKDAAKVLAEDEELY
GDFEDLETGDVHKGKSGPNTQNEDIEKEVKEEIDPDEEESAKKKHLDKKRKLKEMFDAEY
DEGESTYFDDLKGEMQKQAQLNRAEFEDQDDEARVQYEGFRPGMYVRIEIENVPCEFVQN
FDPHYPIILGGLGNSEGNVGYVQMRLKKHRWYKKILKSRDPIIFSVGWRRFQTIPLYYIE
DHNGRQRLLKYTPQHMHCGAAFWGPITPQGTGFLAIQSVSGIMPDFRIAATGVVLDLDKS
IKIVKKLKLTGFPYKIFKNTSFIKGMFNSALEVAKFEGAVIRTVSGIRGQIKKALRAPEG
AFRASFEDKLLMSDIVFMRTWYPVSIPAFYNPVTSLLKPVGEKDTWSGMRTTGQLRLAHG
VRLKANKDSLYKPILRQKKHFNSLHIPKALQKALPFKNKPKTQAKAGKVPKDRRRPAVIR
EPHERKILALLDALSTVHSQKMKKAKEQRHLHNKEHFRAKQKEEEEKLKRQKDLRKKLFR
IQGQKERRNQKSSLKGAEGQLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mq9SI	0.621	0.932	0.000	844	0.653	0.992	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
2	PDB:7mqaSI	0.590	0.929	0.000	803	0.626	0.999	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.
3	AFDB:Q14692	1.000	1.000	0.000	1282	1.000	1.000	Q14692.pdb.gz	BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1
4	PDB:7d63RJ	0.569	0.909	4.305E-81	796	0.319	0.514	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
5	PDB:7ajuCL	0.540	0.849	1.846E-75	808	0.319	0.506	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
6	PDB:7ajtCL	0.555	0.904	9.182E-74	781	0.314	0.515	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
7	PDB:7d4iRJ	0.521	0.899	7.730E-69	738	0.295	0.512	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
8	PDB:7wtlCL	0.435	0.895	5.363E-65	610	0.262	0.551	7wtlCL.pdb.gz	In vitro structural maturation of an early stage pre-40S particle coupled with U3 snoRNA release and central pseudoknot formation.
9	PDB:7wttu	0.342	0.655	8.249E-28	642	0.117	0.234	7wttu.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
10	PDB:6faik	0.321	0.588	5.901E-23	670	0.105	0.201	6faik.pdb.gz	Structure of a eukaryotic cytoplasmic pre-40S ribosomal subunit.
11	PDB:7wtrCC	0.325	0.648	5.171E-22	615	0.104	0.216	7wtrCC.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
12	AFDB:Q8SWT7	0.047	0.065	3.551E-3	694	0.073	0.135	Q8SWT7.pdb.gz	Q8SWT7_DROME RE56367p OS=Drosophila melanogaster OX=7227 GN=dpr17 PE=1 SV=1
13	AFDB:Q6UXX5	0.081	0.079	9.211E-2	1313	0.088	0.086	Q6UXX5.pdb.gz	ITIH6_HUMAN Inter-alpha-trypsin inhibitor heavy chain H6 OS=Homo sapiens OX=9606 GN=ITIH6 PE=1 SV=1
14	AFDB:Q5VWG9	0.037	0.049	9.724E-2	929	0.054	0.074	Q5VWG9.pdb.gz	TAF3_HUMAN Transcription initiation factor TFIID subunit 3 OS=Homo sapiens OX=9606 GN=TAF3 PE=1 SV=1
15	AFDB:Q93WK5	0.073	0.116	1.208E-1	727	0.073	0.128	Q93WK5.pdb.gz	APRR7_ARATH Two-component response regulator-like APRR7 OS=Arabidopsis thaliana OX=3702 GN=APRR7 PE=1 SV=1
16	AFDB:Q9FWW2	0.039	0.070	2.195E-1	483	0.047	0.124	Q9FWW2.pdb.gz	Q9FWW2_ARATH T28K15.14 protein OS=Arabidopsis thaliana OX=3702 GN=At1g12120 PE=1 SV=1
17	AFDB:Q86TB3	0.043	0.031	3.576E-1	2170	0.076	0.045	Q86TB3.pdb.gz	ALPK2_HUMAN Alpha-protein kinase 2 OS=Homo sapiens OX=9606 GN=ALPK2 PE=1 SV=3
18	AFDB:Q9C658	0.039	0.065	3.776E-1	611	0.066	0.137	Q9C658.pdb.gz	DCP5_ARATH Protein decapping 5 OS=Arabidopsis thaliana OX=3702 GN=DCP5 PE=1 SV=1
19	AFDB:Q8BGD7	0.038	0.056	4.953E-1	802	0.062	0.100	Q8BGD7.pdb.gz	NPAS4_MOUSE Neuronal PAS domain-containing protein 4 OS=Mus musculus OX=10090 GN=Npas4 PE=1 SV=1
20	AFDB:Q1X8D7	0.034	0.046	5.828E-1	754	0.069	0.117	Q1X8D7.pdb.gz	LRC36_HUMAN Leucine-rich repeat-containing protein 36 OS=Homo sapiens OX=9606 GN=LRRC36 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F349	0.0	673	1221	0.264	0.278	E7F349_DANRE BMS1 ribosome biogenesis factor OS=Danio rerio OX=7955 GN=bms1l PE=1 SV=2
2	Q14692	0.0	2652	1282	1.000	1.000	BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1
3	Q384C0	0.0	582	1216	0.335	0.353	Q384C0_TRYB2 Bms1-type G domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0820 PE=4 SV=1
4	O94653	2.30e-139	455	1121	0.225	0.257	BMS1_SCHPO Ribosome biogenesis protein bms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bms1 PE=1 SV=2
5	Q08965	2.99e-129	429	1183	0.186	0.202	BMS1_YEAST Ribosome biogenesis protein BMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BMS1 PE=1 SV=1
6	Q8I275	1.41e-60	231	1434	0.097	0.086	Q8I275_PLAF7 Small ribosomal subunit assembling AARP2 protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0106700 PE=4 SV=1
7	O13956	2.61e-19	96.7	783	0.066	0.109	TSR1_SCHPO Ribosome biogenesis protein tsr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tsr1 PE=3 SV=1
8	Q2NL82	1.52e-17	90.9	804	0.066	0.104	TSR1_HUMAN Pre-rRNA-processing protein TSR1 homolog OS=Homo sapiens OX=9606 GN=TSR1 PE=1 SV=1
9	Q07381	1.58e-09	64.7	788	0.065	0.105	TSR1_YEAST Ribosome biogenesis protein TSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSR1 PE=1 SV=1
10	Q5A346	9.47e-05	49.3	842	0.045	0.069	Q5A346_CANAL Tsr1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TSR1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	48	15.8	AAA ATPase domain
2	PF13401 AAA_22	2.4e+02	13.4	AAA domain
3	PF08142 AARP2CN	1.6e-27	106.7	AARP2CN (NUC121) domain
4	PF00009 GTP_EFTU	0.074	24.1	Elongation factor Tu GTP binding domain
5	PF01926 MMR_HSR1	13	17.3	50S ribosome-binding GTPase
6	PF04950 RIBIOP_C	3.8e-94	326.9	40S ribosome biogenesis protein Tsr1 and BMS1 C-terminal
7	PF00910 RNA_helicase	92	14.9	RNA helicase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363642

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232888	0.999	U3 small nucleolar RNA-interacting protein 2
2	9606.ENSP00000244230	0.999	U3 small nucleolar ribonucleoprotein protein MPP10
3	9606.ENSP00000261637	0.999	Small subunit processome component 20 homolog
4	9606.ENSP00000261708	0.999	U3 small nucleolar RNA-associated protein 6 homolog
5	9606.ENSP00000327179	0.999	U3 small nucleolar RNA-associated protein 4 homolog
6	9606.ENSP00000355541	0.999	HEAT repeat-containing protein 1
7	9606.ENSP00000358812	0.999	Protein RRP5 homolog
8	9606.ENSP00000371169	0.999	RNA 3'-terminal phosphate cyclase-like protein
9	9606.ENSP00000405068	0.999	Nucleolar protein 14
10	9606.ENSP00000229214	0.998	KRR1 small subunit processome component homolog
11	9606.ENSP00000257829	0.998	RNA cytidine acetyltransferase
12	9606.ENSP00000264279	0.998	Nucleolar protein 58
13	9606.ENSP00000308179	0.998	WD repeat-containing protein 3
14	9606.ENSP00000363746	0.998	WD repeat-containing protein 46
15	9606.ENSP00000423067	0.998	WD repeat-containing protein 36
16	9606.ENSP00000454836	0.998	Transducin beta-like protein 3
17	9606.ENSP00000225298	0.997	U3 small nucleolar RNA-associated protein 18 homolog
18	9606.ENSP00000230340	0.997	Bystin
19	9606.ENSP00000254803	0.997	Something about silencing protein 10
20	9606.ENSP00000259239	0.997	U3 small nucleolar ribonucleoprotein protein IMP4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.996	protein binding
GO:0003824	0.833	catalytic activity
GO:0016787	0.427	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044238	0.996	primary metabolic process
GO:0043170	0.991	macromolecule metabolic process
GO:0034641	0.988	cellular nitrogen compound metabolic process
GO:0010467	0.967	gene expression
GO:1901360	0.963	organic cyclic compound metabolic process
GO:0090304	0.952	nucleic acid metabolic process
GO:0071840	0.909	cellular component organization or biogenesis
GO:0034660	0.896	ncRNA metabolic process
GO:0042254	0.892	ribosome biogenesis
GO:0034470	0.888	ncRNA processing
GO:0065007	0.775	biological regulation
GO:0050789	0.753	regulation of biological process
GO:0006364	0.737	rRNA processing
GO:0032502	0.663	developmental process
GO:0048856	0.649	anatomical structure development
GO:0032501	0.630	multicellular organismal process
GO:0007275	0.566	multicellular organism development
GO:0048731	0.548	system development
GO:0048513	0.538	animal organ development
GO:0019222	0.458	regulation of metabolic process
GO:0031016	0.458	pancreas development
GO:0001889	0.457	liver development
GO:0060255	0.408	regulation of macromolecule metabolic process
GO:0050794	0.394	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0005694	0.828	chromosome
GO:0005737	0.692	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.427	Hydrolases.

[back to server]