StarFunc result for job id Q14693

User Input

>input (890 residues)
MNYVGQLAGQVFVTVKELYKGLNPATLSGCIDIIVIRQPNGNLQCSPFHVRFGKMGVLRS
REKVVDIEINGESVDLHMKLGDNGEAFFVQETDNDQEVIPMHLATSPILSEGASRMECQL
KRGSVDRMRGLDPSTPAQVIAPSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDED
MFPIEMSSDEAMELLESSRTLPNDIPPFQDDIPEENLSLAVIYPQSASYPNSDREWSPTP
SPSGSRPSTPKSDSELVSKSTERTGQKNPEMLWLWGELPQAAKSSSPHKMKESSPLSSRK
ICDKSHFQAIHSESSDTFSDQSPTLVGGALLDQNKPQTEMQFVNEEDLETLGAAAPLLPM
IEELKPPSASVVQTANKTDSPSRKRDKRSRHLGADGVYLDDLTDMDPEVAALYFPKNGDP
SGLAKHASDNGARSANQSPQSVGSSGVDSGVESTSDGLRDLPSIAISLCGGLSDHREITK
DAFLEQAVSYQQFVDNPAIIDDPNLVVKIGSKYYNWTTAAPLLLAMQAFQKPLPKATVES
IMRDKMPKKGGRWWFSWRGRNTTIKEESKPEQCLAGKAHSTGEQPPQLSLATRVKHESSS
SDEERAAAKPSNAGHLPLLPNVSYKKTLRLTSEQLKSLKLKNGPNDVVFSVTTQYQGTCR
CEGTIYLWNWDDKVIISDIDGTITRSDTLGHILPTLGKDWTHQGIAKLYHKVSQNGYKFL
YCSARAIGMADMTRGYLHWVNERGTVLPQGPLLLSPSSLFSALHREVIEKKPEKFKVQCL
TDIKNLFFPNTEPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYV
RLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JW03	0.522	0.505	0.000	924	0.893	0.860	A0A0G2JW03.pdb.gz	A0A0G2JW03_RAT phosphatidate phosphatase OS=Rattus norvegicus OX=10116 GN=Lpin1 PE=1 SV=2
2	AFDB:Q14693	1.000	1.000	0.000	890	1.000	1.000	Q14693.pdb.gz	LPIN1_HUMAN Phosphatidate phosphatase LPIN1 OS=Homo sapiens OX=9606 GN=LPIN1 PE=1 SV=2
3	AFDB:Q92539	0.406	0.403	1.232E-89	896	0.526	0.522	Q92539.pdb.gz	LPIN2_HUMAN Phosphatidate phosphatase LPIN2 OS=Homo sapiens OX=9606 GN=LPIN2 PE=1 SV=1
4	AFDB:Q9BQK8	0.456	0.474	6.605E-82	851	0.472	0.494	Q9BQK8.pdb.gz	LPIN3_HUMAN Phosphatidate phosphatase LPIN3 OS=Homo sapiens OX=9606 GN=LPIN3 PE=1 SV=3
5	AFDB:Q99PI4	0.446	0.466	4.985E-81	848	0.466	0.489	Q99PI4.pdb.gz	LPIN3_MOUSE Phosphatidate phosphatase LPIN3 OS=Mus musculus OX=10090 GN=Lpin3 PE=1 SV=1
6	AFDB:Q8SXP0	0.417	0.349	2.816E-67	1089	0.357	0.292	Q8SXP0.pdb.gz	Q8SXP0_DROME phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
7	AFDB:A0A0B4JD27	0.376	0.322	1.015E-53	1045	0.347	0.296	A0A0B4JD27.pdb.gz	A0A0B4JD27_DROME Lipin, isoform E OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
8	AFDB:Q9SF47	0.413	0.407	5.458E-50	904	0.260	0.256	Q9SF47.pdb.gz	PAH1_ARATH Phosphatidate phosphatase PAH1 OS=Arabidopsis thaliana OX=3702 GN=PAH1 PE=1 SV=1
9	AFDB:Q9FMN2	0.389	0.373	4.116E-48	930	0.264	0.253	Q9FMN2.pdb.gz	PAH2_ARATH Phosphatidate phosphatase PAH2 OS=Arabidopsis thaliana OX=3702 GN=PAH2 PE=1 SV=1
10	PDB:3l8hA	0.125	0.517	1.235E-2	179	0.026	0.128	3l8hA.pdb.gz	Structural Determinants of Substrate Recognition in the HAD Superfamily Member d-glycero-d-manno-Heptose-1,7-bisphosphate Phosphatase (GmhB) .
11	PDB:2ia5H	0.113	0.299	2.290E-2	301	0.031	0.093	2ia5H.pdb.gz	Structure-function analysis of the 3' phosphatase component of T4 polynucleotide kinase/phosphatase.
12	PDB:5it0A	0.070	0.128	2.562E-2	396	0.030	0.068	5it0A.pdb.gz	SAD phasing using iodide ions in a high-throughput structural genomics environment.
13	PDB:6hyjB	0.058	0.195	4.014E-2	223	0.021	0.085	6hyjB.pdb.gz	Crystal structures and snapshots along the reaction pathway of human phosphoserine phosphatase.
14	AFDB:P46889	0.056	0.041	4.216E-2	1329	0.129	0.087	P46889.pdb.gz	FTSK_ECOLI DNA translocase FtsK OS=Escherichia coli (strain K12) OX=83333 GN=ftsK PE=1 SV=2
15	PDB:7z8fj	0.060	0.117	1.305E-1	330	0.035	0.094	7z8fj.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
16	PDB:3n1cA	0.085	0.180	1.634E-1	309	0.030	0.087	3n1cA.pdb.gz	The Crystal Complex of Phosphofructokinase-2 of Escherichia coli with Fructose-6-phosphate: KINETIC AND STRUCTURAL ANALYSIS OF THE ALLOSTERIC ATP INHIBITION.
17	PDB:6cjzA	0.038	0.235	1.728E-1	105	0.007	0.057	6cjzA.pdb.gz
18	PDB:6hd8A	0.037	0.067	1.933E-1	461	0.015	0.028	6hd8A.pdb.gz	Structural basis for ion selectivity in TMEM175 K+channels.
19	PDB:6dlfA	0.035	0.112	2.163E-1	236	0.008	0.030	6dlfA.pdb.gz
20	PDB:7bssA	0.067	0.071	3.029E-1	816	0.017	0.018	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JW03	0.0	1554	973	0.892	0.816	A0A0G2JW03_RAT phosphatidate phosphatase OS=Rattus norvegicus OX=10116 GN=Lpin1 PE=1 SV=2
2	A0A8I5ZPU6	0.0	1540	940	0.892	0.845	A0A8I5ZPU6_RAT phosphatidate phosphatase OS=Rattus norvegicus OX=10116 GN=Lpin1 PE=1 SV=1
3	F7FDH2	0.0	1543	950	0.892	0.836	F7FDH2_RAT phosphatidate phosphatase OS=Rattus norvegicus OX=10116 GN=Lpin1 PE=1 SV=1
4	Q14693	0.0	1848	890	1.000	1.000	LPIN1_HUMAN Phosphatidate phosphatase LPIN1 OS=Homo sapiens OX=9606 GN=LPIN1 PE=1 SV=2
5	Q5XIM8	0.0	1557	924	0.892	0.859	Q5XIM8_RAT phosphatidate phosphatase OS=Rattus norvegicus OX=10116 GN=Lpin1 PE=1 SV=1
6	Q91ZP3	0.0	1565	924	0.890	0.857	LPIN1_MOUSE Phosphatidate phosphatase LPIN1 OS=Mus musculus OX=10090 GN=Lpin1 PE=1 SV=1
7	Q92539	0.0	842	896	0.527	0.523	LPIN2_HUMAN Phosphatidate phosphatase LPIN2 OS=Homo sapiens OX=9606 GN=LPIN2 PE=1 SV=1
8	Q99PI4	0.0	724	848	0.475	0.499	LPIN3_MOUSE Phosphatidate phosphatase LPIN3 OS=Mus musculus OX=10090 GN=Lpin3 PE=1 SV=1
9	Q99PI5	0.0	842	893	0.526	0.524	LPIN2_MOUSE Phosphatidate phosphatase LPIN2 OS=Mus musculus OX=10090 GN=Lpin2 PE=1 SV=2
10	Q9BQK8	0.0	738	851	0.472	0.494	LPIN3_HUMAN Phosphatidate phosphatase LPIN3 OS=Homo sapiens OX=9606 GN=LPIN3 PE=1 SV=3
11	E5DK16	2.45e-121	393	962	0.254	0.235	E5DK16_DROME Lipin isoform J OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
12	A8DY69	1.39e-120	392	1035	0.254	0.218	A8DY69_DROME phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
13	A0A0B4JD00	1.94e-119	389	1034	0.254	0.219	A0A0B4JD00_DROME phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
14	A0A0B4JCS1	4.86e-112	369	1016	0.244	0.214	A0A0B4JCS1_DROME Lipin, isoform G OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
15	I0E2I4	1.10e-111	369	1043	0.244	0.208	I0E2I4_DROME phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
16	Q8SXP0	2.55e-111	369	1089	0.244	0.199	Q8SXP0_DROME phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
17	A0A0B4JCQ5	2.89e-110	366	1088	0.244	0.199	A0A0B4JCQ5_DROME phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
18	A0A0B4JD31	7.75e-101	338	992	0.236	0.212	A0A0B4JD31_DROME Lipin, isoform L OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
19	A0A0B4JD27	4.91e-91	313	1045	0.226	0.192	A0A0B4JD27_DROME Lipin, isoform E OS=Drosophila melanogaster OX=7227 GN=Lpin PE=1 SV=1
20	Q9FMN2	1.09e-75	268	930	0.172	0.165	PAH2_ARATH Phosphatidate phosphatase PAH2 OS=Arabidopsis thaliana OX=3702 GN=PAH2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09949 APP1_cat	0.085	24.2	Phosphatidate phosphatase APP1, catalytic domain
2	PF16876 Lipin_mid	5.2e-31	117.9	Lipin/Ned1/Smp2 multi-domain protein middle domain
3	PF04571 Lipin_N	6.2e-42	153.1	lipin, N-terminal conserved region
4	PF08235 LNS2	1.1e-100	347.3	LNS2 (Lipin/Ned1/Smp2)
5	PF15017 WRNPLPNID	9.9e+02	12.0	Putative WW-binding domain and destruction box

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000020054

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000023181	0.947	Uncharacterized protein
2	9598.ENSPTRP00000052392	0.930	Phosphatidate cytidylyltransferase
3	9598.ENSPTRP00000034315	0.927	Lipoprotein lipase
4	9598.ENSPTRP00000048655	0.924	1-acyl-sn-glycerol-3-phosphate acyltransferase
5	9598.ENSPTRP00000014785	0.911	CTD nuclear envelope phosphatase 1
6	9598.ENSPTRP00000016737	0.905	Lipin 2
7	9598.ENSPTRP00000007025	0.890	Diacylglycerol O-acyltransferase 2
8	9598.ENSPTRP00000030753	0.885	1-acylglycerol-3-phosphate O-acyltransferase 1 (Lysophosphatidic acid acyltransferase, alpha)
9	9598.ENSPTRP00000003562	0.880	Glyceronephosphate O-acyltransferase
10	9598.ENSPTRP00000034531	0.877	Phosphatidic acid phosphatase type 2 domain containing 1B
11	9598.ENSPTRP00000056052	0.877	Phosphatidic acid phosphatase type 2 domain containing 1A
12	9598.ENSPTRP00000000280	0.876	Serine/threonine-protein kinase mTOR
13	9598.ENSPTRP00000028918	0.842	Uncharacterized protein
14	9598.ENSPTRP00000040261	0.842	Uncharacterized protein
15	9598.ENSPTRP00000008412	0.841	Glycerol-3-phosphate dehydrogenase 1 (soluble)
16	9598.ENSPTRP00000044968	0.832	Glycerol-3-phosphate dehydrogenase 2 (Mitochondrial)
17	9598.ENSPTRP00000061020	0.816	Transmembrane protein 188
18	9598.ENSPTRP00000007024	0.810	Monoacylglycerol O-acyltransferase 2
19	9598.ENSPTRP00000022172	0.810	Uncharacterized protein
20	9598.ENSPTRP00000033425	0.797	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008195	1.000	phosphatidate phosphatase activity
GO:0097159	0.357	organic cyclic compound binding
GO:1901363	0.345	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044255	0.976	cellular lipid metabolic process
GO:0046486	0.971	glycerolipid metabolic process
GO:0050789	0.969	regulation of biological process
GO:0019222	0.957	regulation of metabolic process
GO:0080090	0.952	regulation of primary metabolic process
GO:0048522	0.946	positive regulation of cellular process
GO:0009893	0.945	positive regulation of metabolic process
GO:0031323	0.942	regulation of cellular metabolic process
GO:0048523	0.940	negative regulation of cellular process
GO:0050896	0.938	response to stimulus
GO:0046473	0.932	phosphatidic acid metabolic process
GO:0046474	0.921	glycerophospholipid biosynthetic process
GO:0051716	0.909	cellular response to stimulus
GO:0019216	0.904	regulation of lipid metabolic process
GO:0031325	0.870	positive regulation of cellular metabolic process
GO:0006654	0.867	phosphatidic acid biosynthetic process
GO:0009889	0.834	regulation of biosynthetic process
GO:0065009	0.798	regulation of molecular function
GO:0046890	0.798	regulation of lipid biosynthetic process
GO:0051171	0.783	regulation of nitrogen compound metabolic process
GO:0009892	0.780	negative regulation of metabolic process
GO:0042221	0.774	response to chemical
GO:0090207	0.774	regulation of triglyceride metabolic process
GO:0045936	0.772	negative regulation of phosphate metabolic process
GO:0032869	0.754	cellular response to insulin stimulus
GO:0032502	0.748	developmental process
GO:0045833	0.731	negative regulation of lipid metabolic process
GO:0006639	0.731	acylglycerol metabolic process
GO:0071840	0.714	cellular component organization or biogenesis
GO:0006641	0.710	triglyceride metabolic process
GO:0010921	0.705	regulation of phosphatase activity
GO:0016043	0.701	cellular component organization
GO:0071071	0.697	regulation of phospholipid biosynthetic process
GO:0051055	0.695	negative regulation of lipid biosynthetic process
GO:0010923	0.677	negative regulation of phosphatase activity
GO:0060255	0.669	regulation of macromolecule metabolic process
GO:0046463	0.619	acylglycerol biosynthetic process
GO:0019432	0.614	triglyceride biosynthetic process
GO:0006996	0.566	organelle organization
GO:0019219	0.474	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.457	positive regulation of macromolecule metabolic process
GO:0006997	0.431	nucleus organization
GO:0051173	0.425	positive regulation of nitrogen compound metabolic process
GO:0045935	0.400	positive regulation of nucleobase-containing compound metabolic process
GO:0010256	0.386	endomembrane system organization
GO:0006998	0.376	nuclear envelope organization
GO:0051054	0.371	positive regulation of DNA metabolic process
GO:0048856	0.370	anatomical structure development
GO:0031326	0.353	regulation of cellular biosynthetic process
GO:0048513	0.333	animal organ development
GO:0051239	0.303	regulation of multicellular organismal process
GO:0050793	0.300	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	1.000	organelle membrane
GO:0005634	0.999	nucleus
GO:0005783	0.999	endoplasmic reticulum
GO:0031981	0.993	nuclear lumen
GO:0005829	0.988	cytosol
GO:0005654	0.977	nucleoplasm
GO:0031975	0.968	envelope
GO:0031967	0.945	organelle envelope
GO:0005789	0.940	endoplasmic reticulum membrane
GO:0005635	0.877	nuclear envelope
GO:0032991	0.358	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:27429	1.000	a 1,2-diacyl-sn-glycero-3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate
EC:3.1.3.4	1.000	phosphatidate phosphatase.

[back to server]